Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 2.56052592670486E-5
breast carcinoma 1614 0.00280539609383592

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.500 0.003
group 4 medulloblastoma -1.200 0.000

Synonym

Accession Q8WXC6 Q8N110
Symbols CSNAP
MYEOV2

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Cow EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

Gene RIF (1)

PMID Text
23776465 Myeloma overexpressed 2 (Myeov2) regulates L11 subnuclear localization through Nedd8 modification.

AA Sequence

MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ                   1 - 57
//

Text Mined References (6)

PMID Year Title
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23776465 2013 Myeloma overexpressed 2 (Myeov2) regulates L11 subnuclear localization through Nedd8 modification.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.