Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.500 0.003
group 4 medulloblastoma -1.200 0.000

Gene RIF (1)

PMID Text
23776465 Myeloma overexpressed 2 (Myeov2) regulates L11 subnuclear localization through Nedd8 modification.

AA Sequence

MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ                   1 - 57
//

Publication (6)

PMID Year Title
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23776465 2013 Myeloma overexpressed 2 (Myeov2) regulates L11 subnuclear localization through Nedd8 modification.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.