Property Summary

NCBI Gene PubMed Count 11
PubMed Score 750.01
PubTator Score 22.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 9.8e-13

Synonym

Accession Q8WXC3 B2R8L4 Q8NFP8
Symbols ASC2
POP1
PYC1
cPOP1

Gene

PDB

2HM2   4QOB  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV      1 - 70
AVLRDMRMLEEAARLQRAA                                                        71 - 89
//

Text Mined References (14)

PMID Year Title