Property Summary

NCBI Gene PubMed Count 10
Grant Count 23
R01 Count 6
Funding $1,973,164.42
PubMed Score 721.51
PubTator Score 22.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Gene RIF (6)

PMID Text
26510601 Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever.
23519807 X-ray diffraction data were collected to a resolution of 3.6 A from a crystal belonging to the cubic space group P23 with unit-cell parameters a=b=c=94.12 A, alpha=beta=gamma=90.00 degrees .
16905547 ASC2 is a pyrin domain-only protein that regulates inflammatory signaling
16403450 analysis of the 3D structure of human ASC2 protein involved in apoptosis and inflammation
12656673 POP1/ASC2 associates with ASC via PAAD-PAAD interactions and modulates NF-kappa B and pro-caspase-1 regulation by this adapter protein
12153040 NMR assignment of human ASC2, a self contained protein interaction domain involved in apoptosis and inflammation.

AA Sequence

MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV      1 - 70
AVLRDMRMLEEAARLQRAA                                                        71 - 89
//

Text Mined References (13)

PMID Year Title
26510601 [Influence of M680I and M694V mutations on pyrin's domain B30.2 tertiary structure and it's complex formation ability with caspase-1].
24871464 2014 The CLRX.1/NOD24 (NLRP2P) pseudogene codes a functional negative regulator of NF-?B, pyrin-only protein 4.
23519807 2013 Crystallization and preliminary X-ray crystallographic studies of cPOP1.
17178784 2007 Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation.
16905547 2006 Structure and dynamics of ASC2, a pyrin domain-only protein that regulates inflammatory signaling.
16403450 2006 Determining the 3D structure of human ASC2 protein involved in apoptosis and inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12656673 2003 The PAAD/PYRIN-only protein POP1/ASC2 is a modulator of ASC-mediated nuclear-factor-kappa B and pro-caspase-1 regulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...