Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.66
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.068 1.4e-03
adult high grade glioma 1.200 2.5e-04
atypical teratoid / rhabdoid tumor 1.300 3.0e-05
glioblastoma 1.200 1.9e-04
group 3 medulloblastoma 1.600 7.0e-05
lung cancer 1.500 1.0e-04
medulloblastoma, large-cell 1.500 4.8e-04
osteosarcoma -2.821 1.1e-10
posterior fossa group B ependymoma 1.100 6.3e-07
primitive neuroectodermal tumor 1.100 8.5e-04

Gene RIF (2)

AA Sequence

MAAINPWASWGALTDQSWGMTAVDPWASWALCPQYPAWHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVD      1 - 70
FTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEPWSVEQACPQRTCPEWVRNLE     71 - 140
SKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCKDQLEMYHMNQSTAMRQMVFMQKQVLSQRSS    141 - 210
EFCGLGAEFSQNLNFVPSQRVSQIEHFYKPDTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPA    211 - 280
RIQTGDNLFKCTDAVKSFNHIIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEY    281 - 350
ENIFYFSSFMEHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKK    351 - 420
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTGEKPYVCNECG    421 - 490
KSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCDECEKAFRDYSALSKHER    491 - 560
THSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEIIHSGIKPYECNKCG    561 - 630
KSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRR    631 - 700
THTGEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECG    701 - 770
KAFSGHSALLQHQRNHSEEKLN                                                    771 - 792
//

Text Mined References (9)

PMID Year Title