Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.48
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.821 0.000
medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.100 0.001
adrenocortical carcinoma 1.068 0.001
lung cancer 1.500 0.000
adult high grade glioma 1.200 0.000
posterior fossa group B ependymoma 1.100 0.000

Gene RIF (1)

PMID Text
15964554 results suggest that ZNF328 protein may act as a transcriptional repressor in mitogen-activated protein kinase (MAPK) signaling pathway to mediate cellular functions

AA Sequence

MAAINPWASWGALTDQSWGMTAVDPWASWALCPQYPAWHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVD      1 - 70
FTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEPWSVEQACPQRTCPEWVRNLE     71 - 140
SKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCKDQLEMYHMNQSTAMRQMVFMQKQVLSQRSS    141 - 210
EFCGLGAEFSQNLNFVPSQRVSQIEHFYKPDTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPA    211 - 280
RIQTGDNLFKCTDAVKSFNHIIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEY    281 - 350
ENIFYFSSFMEHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKK    351 - 420
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTGEKPYVCNECG    421 - 490
KSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCDECEKAFRDYSALSKHER    491 - 560
THSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEIIHSGIKPYECNKCG    561 - 630
KSCSQMAHLVRHQRTHTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRR    631 - 700
THTGEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECG    701 - 770
KAFSGHSALLQHQRNHSEEKLN                                                    771 - 792
//

Text Mined References (7)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15964554 2005 ZNF328, a novel human zinc-finger protein, suppresses transcriptional activities of SRE and AP-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.