Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.05
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23921388 methyltransferase METTL21A is the enzyme responsible for trimethylation of a conserved lysine residue found in several human Hsp70 (HSPA) proteins
23349634 METTL21A trimethylates Lys-561 in Hsp70 and corresponding residues in other isoforms (Hsc70, BiP)

AA Sequence

MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV      1 - 70
ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI     71 - 140
LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQ    141 - 210
KRNQKEDL                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23183491 2014 Genome-wide association study identifies a potent locus associated with human opioid sensitivity.
22948820 2012 Lysine methylation of VCP by a member of a novel human protein methyltransferase family.
21516116 2011 Next-generation sequencing to generate interactome datasets.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...