Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.14
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV      1 - 70
ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI     71 - 140
LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFTVRKVHYDPEKDVHIYEAQ    141 - 210
KRNQKEDL                                                                  211 - 218
//

Text Mined References (11)

PMID Year Title