Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
Funding $509,546.5
PubMed Score 4.86
PubTator Score 11.54

Knowledge Summary

Patent (251)

Gene RIF (12)

PMID Text
24477975 Our study indicates, for the first time, an association between variants of HTR3C and severity of chemotherapy-induced symptoms
23928294 The association findings of the HTR3C and the HTR3E remained significant after correction for the number of variants investigated.
21192076 Data show that 5-HT3C, 5-HT3D, and 5-HT3E subunits are coexpressed with 5-HT3A in cell bodies of myenteric neurons, and that 5-HT3A and 5-HT3D were expressed in submucosal plexus of the human large intestine.
20538960 Observational study of gene-disease association. (HuGE Navigator)
20356718 Observational study of gene-disease association. (HuGE Navigator)
20021265 Polymorphisms in the subunit gene HTR3C of the serotonin receptor may be involved in the pathogenesis of pregnancy-associated nausea.
20021265 Observational study of gene-disease association. (HuGE Navigator)
19794330 Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed.
19035560 HTR3C represents a novel candidate locus for autism spectrum disorders and should be tested in other populations.
18681779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISF      1 - 70
TLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGL     71 - 140
TAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRKVIQ    141 - 210
TQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAP    211 - 280
FKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSL    281 - 350
LLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH    351 - 420
AMDTLLFRLYLLFMASSILTVIVLWNT                                               421 - 447
//

Publication (19)

PMID Year Title
24603532 2014 ABCC5, a gene that influences the anterior chamber depth, is associated with primary angle closure glaucoma.
24477975 2014 Association between variants of 5-hydroxytryptamine receptor 3C (HTR3C) and chemotherapy-induced symptoms in women receiving adjuvant treatment for breast cancer.
23928294 2014 5-HT3 receptor influences the washing phenotype and visual organization in obsessive-compulsive disorder supporting 5-HT3 receptor antagonists as novel treatment option.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21192076 2011 Serotonin receptor diversity in the human colon: Expression of serotonin type 3 receptor subunits 5-HT3C, 5-HT3D, and 5-HT3E.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20356718 2010 A coding variant of the novel serotonin receptor subunit 5-HT3E influences sustained attention in schizophrenia patients.
20021265 2010 Two naturally occurring variants of the serotonin receptor gene HTR3C are associated with nausea in pregnancy.
19794330 2009 Influence of 5-HT3 receptor subunit genes HTR3A, HTR3B, HTR3C, HTR3D and HTR3E on treatment response to antipsychotics in schizophrenia.
19035560 2009 Allelic variants in HTR3C show association with autism.
More...