Property Summary

Ligand Count 2
NCBI Gene PubMed Count 18
PubMed Score 5.03
PubTator Score 11.54

Knowledge Summary

Patent (251)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.3e-03

Gene RIF (13)

AA Sequence

MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNYSIPTRVNISF      1 - 70
TLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGL     71 - 140
TAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTFSSFLYTVDSMLLGMDKEVWEITDTSRKVIQ    141 - 210
TQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAP    211 - 280
FKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSL    281 - 350
LLHCTSPGRCCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH    351 - 420
AMDTLLFRLYLLFMASSILTVIVLWNT                                               421 - 447
//

Text Mined References (20)

PMID Year Title