Property Summary

NCBI Gene PubMed Count 7
PubMed Score 29.80
PubTator Score 11.75

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
25637620 PATE1 has a role in sperm-egg penetration and sperm motility
22402205 PATE proteins are involved in sperm-oolemma fusion and penetration but not sperm-zona binding.
18387948 analysis of PATE, expressed primarily in prostate and less in testis, and additional PATE-like genes PATE-M, PATE-DJ, and PATE-B

AA Sequence

MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKCSRGRGICTAT      1 - 70
TEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHDLCNEDL                   71 - 126
//

Text Mined References (8)

PMID Year Title
25637620 2015 Aged men share the sperm protein PATE1 defect with young asthenozoospermia patients.
25416956 2014 A proteome-scale map of the human interactome network.
22402205 2012 Involvement of the prostate and testis expression (PATE)-like proteins in sperm-oocyte interaction.
18387948 2008 PATE gene clusters code for multiple, secreted TFP/Ly-6/uPAR proteins that are expressed in reproductive and neuron-rich tissues and possess neuromodulatory activity.
15798027 2005 The PATE gene is expressed in the accessory tissues of the human male genital tract and encodes a secreted sperm-associated protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11880645 2002 PATE, a gene expressed in prostate cancer, normal prostate, and testis, identified by a functional genomic approach.