Property Summary

NCBI Gene PubMed Count 8
PubMed Score 31.29
PubTator Score 11.75

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKCSRGRGICTAT      1 - 70
TEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHDLCNEDL                   71 - 126
//

Text Mined References (9)

PMID Year Title