Property Summary

NCBI Gene PubMed Count 54
Grant Count 5
R01 Count 1
Funding $279,878.38
PubMed Score 0.00
PubTator Score 79.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.176 0.000
psoriasis 3.700 0.000

Gene RIF (47)

PMID Text
27043315 the NLRP7 inflammasome contributes to IL-1beta secretion and induction of pyroptosis in response to M. bovis infection in THP-1 macrophages.
26544189 maternal-effect mutations of NLRP7 are associated with the most severe form of multi-locus imprinting defects in humans
26143398 These results provide novel insights into the mechanism of NLRP7 inflammasome assembly.
26121690 NLRP7 is involved in Hydatidiform Molar Pregnancy (HYDM1) and interacts with the transcriptional repressor ZBTB16
25376457 No disease-causing mutations were identified in NLRP2, NLRP7 and KHDC3L in cohorts of unexplained infertility and recurrent pregnancy loss.
25358348 NLRP7 and KHDC3L localize to the cytoskeleton and are predominant at the cortical region in growing oocytes.
25097207 NLRP7, depending on the severity of its mutations, regulates the imprinted expression of p57KIP2 and consequently the balance between tissue differentiation and proliferation during early human development.
24105752 The absence of mutations in women with Androgenetic complete hydatidiform moles supports a role for NLRP7 or KHDC3L in Biparental hydatidiform moles only.
24105472 NLRP7 thus appears to function in chromatin reprogramming and DNA methylation in the germline or early embryonic development.NLRP7 affects trophoblast lineage differentiation, binds to overexpressed YY1 and alters CpG methylation.
23963444 A statistically non-significant tendency of non-synonymous variants in NLRP7 more frequent in women with familial hydatidiform mole and in women with female family members with hydatidiform mole or non-mole miscarriage.
More...

AA Sequence

MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNA      1 - 70
TVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEKEGWRNSMEKQSLVWKNTFWQ     71 - 140
GDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTLRYAFYL    141 - 210
SCKELSRMGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVP    211 - 280
VLLGSLLKRKMLPRAALLVTTRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELM    281 - 350
RSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA    351 - 420
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYALEKEEGEDR    421 - 490
DGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGCRMSPDIKQELLQCKAHLHAN    491 - 560
KPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFL    561 - 630
ENYMDFELDIEFERCTYLTIPNWARQDLRSLRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHVT    631 - 700
RSTCHLQKVEIKNVTPDTAYRDFCLAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLRNHKCNLQYLRLGG    701 - 770
HCATPEQWAEFFYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRPKHFLQMLSLENCRLTEASCKDLAA    771 - 840
VLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQEACSLTNLDL    841 - 910
SINQIARGLWILCQALENPNCNLKHLRLKTYETNLEIKKLLEEVKEKNPKLTIDCNASGATAPPCCDFFC    911 - 980
//

Text Mined References (56)

PMID Year Title
27043315 2016 Virulent Mycobacterium bovis Beijing Strain Activates the NLRP7 Inflammasome in THP-1 Macrophages.
26544189 2015 Absence of Maternal Methylation in Biparental Hydatidiform Moles from Women with NLRP7 Maternal-Effect Mutations Reveals Widespread Placenta-Specific Imprinting.
26143398 2015 ATP binding by NLRP7 is required for inflammasome activation in response to bacterial lipopeptides.
26121690 2015 NLRP7, Involved in Hydatidiform Molar Pregnancy (HYDM1), Interacts with the Transcriptional Repressor ZBTB16.
25376457 2015 No evidence for mutations in NLRP7, NLRP2 or KHDC3L in women with unexplained recurrent pregnancy loss or infertility.
25358348 2015 NLRP7 and KHDC3L, the two maternal-effect proteins responsible for recurrent hydatidiform moles, co-localize to the oocyte cytoskeleton.
25097207 2014 Comprehensive genotype-phenotype correlations between NLRP7 mutations and the balance between embryonic tissue differentiation and trophoblastic proliferation.
24105752 2013 No evidence for mutations in NLRP7 and KHDC3L in women with androgenetic hydatidiform moles.
24105472 2014 NLRP7 affects trophoblast lineage differentiation, binds to overexpressed YY1 and alters CpG methylation.
23963444 2013 NLRP7 or KHDC3L genes and the etiology of molar pregnancies and recurrent miscarriage.
More...