Property Summary

NCBI Gene PubMed Count 64
Grant Count 24
R01 Count 17
Funding $3,673,662.66
PubMed Score 485.49
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.003
interstitial lung disease 1.400 0.042
psoriasis -1.100 0.027
astrocytoma 1.800 0.032
glioblastoma 1.700 0.002
osteosarcoma 1.405 0.020
posterior fossa group A ependymoma 1.500 0.000
cystic fibrosis -1.552 0.000
atypical teratoid / rhabdoid tumor 1.600 0.002
medulloblastoma, large-cell -1.400 0.002
adrenocortical carcinoma -1.612 0.014
tuberculosis and treatment for 6 months -1.400 0.003
primary pancreatic ductal adenocarcinoma 3.827 0.000
lung cancer -1.600 0.000
colon cancer -2.100 0.010
active Crohn's disease 1.290 0.019
pancreatic cancer 3.800 0.000
pediatric high grade glioma 1.100 0.000
group 4 medulloblastoma -1.900 0.000
pilocytic astrocytoma 1.500 0.000
subependymal giant cell astrocytoma 2.584 0.003
lung carcinoma -1.100 0.000
spina bifida -1.522 0.017
Breast cancer -1.200 0.000
ulcerative colitis 1.200 0.000
ovarian cancer 3.000 0.000
Down syndrome 1.900 0.005

 GO Function (1)

Gene RIF (42)

PMID Text
27088725 Palladin role in the vascular smooth muscle cell differentiation and gene expression
27023252 stromal palladin expression is a surrogate indicator of the treatment effect after chemoradiation therapy.
26200861 Study identified the actin-associated protein palladin as a key node in signaling pathways that result in fibroblast activation in the increased tissue stiffness of a tumor microenvironment
24989798 Palladin interacts with MT1-MMP to promote tumor cell invasion in breast carcinoma.
24525547 Palladin seems to regulate podosome and invodopodia formation through Rho GTPases. [Review]
24496446 palladin functions as a dynamic scaffolding protein that promotes the assembly of dorsal stress fibers by recruiting VASP to these structures.
22291919 A model whereby palladin-activated fibroblasts facilitate stromal-dependent metastasis and outgrowth of tumorigenic epithelium.
22216253 results indicate that palladin phosphorylation by ERK has an anti-migratory function, possibly by modulating interactions with molecules that regulate cell migration
21868544 Palladin may identify primary pancreatic endocrine neoplasms with a propensity to metastasize to the liver
21782789 these results suggested that palladin played a specific role in modulating the subcellular localization of the cytoplasmic ILKAP and promoting the ILKAP-induced apoptosis.
More...

AA Sequence

MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFST      1 - 70
SPASLCEHPSHKETKLGEHASRRPQDNRSTPVQPLAEKQTKSISSPVSKRKPAMSPLLTRPSYIRSLRKA     71 - 140
EKRGAKTPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSPKNQ    141 - 210
PSALLSASASQSPMEDQGEMEREVKSPGARHCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQ    211 - 280
EVAEGSRVYLECRVTGNPTPRVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPS    281 - 350
GSDTTSAEVFIEGASSTDSDSESLAFKSRAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQ    351 - 420
VHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQWFRQGSEIQDSPDFRIL    421 - 490
QKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTSANTENCSYESMGESNNDHFQ    491 - 560
HFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSN    561 - 630
KSLPTPAVLLSPTKEPPPLLAKPKLDPLKLQQLQNQIRLEQEAGARQPPPAPRSAPPSPPFPPPPAFPEL    631 - 700
AACTPPASPEPMSALASRSAPAMQSSGSFNYARPKQFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPR    701 - 770
QFGRAPVPPFAQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPPPPLPSPGQASHCSSP    771 - 840
ATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGTKDAVIQDLER    841 - 910
KLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSP    911 - 980
VDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTI    981 - 1050
QRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRD   1051 - 1120
SGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGV   1121 - 1190
HSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGV   1191 - 1260
PPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWH   1261 - 1330
QQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL                    1331 - 1383
//

Publication (73)

PMID Year Title
27088725 2016 Redox-Sensitive Regulation of Myocardin-Related Transcription Factor (MRTF-A) Phosphorylation via Palladin in Vascular Smooth Muscle Cell Differentiation Marker Gene Expression.
27023252 2016 Stromal Palladin Expression Is an Independent Prognostic Factor in Pancreatic Ductal Adenocarcinoma.
26200861 2015 Palladin mediates stiffness-induced fibroblast activation in the tumor microenvironment.
24989798 2014 Actin-associated protein palladin promotes tumor cell invasion by linking extracellular matrix degradation to cell cytoskeleton.
24525547 2014 Palladin regulation of the actin structures needed for cancer invasion.
24496446 2014 Palladin promotes assembly of non-contractile dorsal stress fibers through VASP recruitment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22291919 2012 Arousal of cancer-associated stroma: overexpression of palladin activates fibroblasts to promote tumor invasion.
22216253 2011 Role of palladin phosphorylation by extracellular signal-regulated kinase in cell migration.
More...