Property Summary

NCBI Gene PubMed Count 65
PubMed Score 528.78
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.186 9.1e-03
adrenocortical carcinoma -1.612 1.4e-02
astrocytoma 1.200 5.1e-19
Astrocytoma, Pilocytic 1.300 2.7e-06
atypical teratoid / rhabdoid tumor 1.100 1.8e-02
Breast cancer -1.200 3.1e-07
colon cancer -2.100 1.0e-02
cystic fibrosis -1.552 1.5e-05
Down syndrome 1.600 2.0e-02
ependymoma 1.100 9.1e-07
glioblastoma 1.600 5.2e-03
group 4 medulloblastoma -1.900 2.7e-04
interstitial lung disease 1.400 4.2e-02
lung cancer -1.300 1.5e-02
lung carcinoma -1.100 2.3e-11
medulloblastoma, large-cell -1.400 1.6e-03
osteosarcoma 1.048 4.9e-02
ovarian cancer -2.400 2.7e-05
pancreatic cancer 1.100 8.1e-03
pediatric high grade glioma 1.100 1.0e-04
primary pancreatic ductal adenocarcinoma 3.677 1.4e-04
psoriasis -1.100 2.7e-02
Rheumatoid arthritis 2.000 3.0e-03
spina bifida -1.501 3.5e-02
subependymal giant cell astrocytoma 2.200 1.7e-02
tuberculosis and treatment for 3 months -1.300 5.8e-03
ulcerative colitis 1.100 2.7e-05

Gene RIF (43)

AA Sequence

MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFST      1 - 70
SPASLCEHPSHKETKLGEHASRRPQDNRSTPVQPLAEKQTKSISSPVSKRKPAMSPLLTRPSYIRSLRKA     71 - 140
EKRGAKTPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSPKNQ    141 - 210
PSALLSASASQSPMEDQGEMEREVKSPGARHCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQ    211 - 280
EVAEGSRVYLECRVTGNPTPRVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPS    281 - 350
GSDTTSAEVFIEGASSTDSDSESLAFKSRAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQ    351 - 420
VHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQWFRQGSEIQDSPDFRIL    421 - 490
QKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTSANTENCSYESMGESNNDHFQ    491 - 560
HFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSN    561 - 630
KSLPTPAVLLSPTKEPPPLLAKPKLDPLKLQQLQNQIRLEQEAGARQPPPAPRSAPPSPPFPPPPAFPEL    631 - 700
AACTPPASPEPMSALASRSAPAMQSSGSFNYARPKQFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPR    701 - 770
QFGRAPVPPFAQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPPPPLPSPGQASHCSSP    771 - 840
ATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGTKDAVIQDLER    841 - 910
KLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYRLERSP    911 - 980
VDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTI    981 - 1050
QRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRD   1051 - 1120
SGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGV   1121 - 1190
HSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGV   1191 - 1260
PPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWH   1261 - 1330
QQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL                    1331 - 1383
//

Text Mined References (74)

PMID Year Title