Property Summary

NCBI Gene PubMed Count 34
Grant Count 17
R01 Count 11
Funding $1,112,537.91
PubMed Score 15.34
PubTator Score 13.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 0.000
ovarian cancer 1.700 0.000

Gene RIF (22)

PMID Text
26010750 both human and mouse NELF-B proteins are translated from a non-AUG codon upstream of the annotated AUG.
24636995 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24636995 Knockdown of NELF-B by shRNA enhances HIV-1 transcription in latently infected cells
24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24097989 These studies allow us to position the actions of two new modulators of GR-regulated transactivation, NELF-A and NELF-B, relative to other factors in the overall gene induction sequence.
23518577 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
23518577 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
19245807 data show that NELF subunits exhibit highly specific subcellular localizations, such as in NELF bodies or in midbodies, and some shuttle actively between the nucleus and cytoplasm; loss of NELF from cells can lead to enlarged and/or multiple nuclei
18071589 COBRA1 and BRCA1 may engage in common gene regulatory pathways to suppress breast cancer progression.
17910036 a lack of COBRA1 expression in breast carcinoma may serve as a useful indicator for poor prognosis.
More...

AA Sequence

MFAGLQDLGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELR      1 - 70
DKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRA     71 - 140
CAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGEVVQRLTRMVGK    141 - 210
NVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRA    211 - 280
RELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQG    281 - 350
AWDMIDSQVFKEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRM    351 - 420
ACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADEFALEDFCSSLFDGFF    421 - 490
LTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLDHRKPSPAQ    491 - 560
AAETPALELPLPSVPAPAPL                                                      561 - 580
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26010750 2015 Translational Initiation at a Non-AUG Start Codon for Human and Mouse Negative Elongation Factor-B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097989 2013 A conserved protein motif is required for full modulatory activity of negative elongation factor subunits NELF-A and NELF-B in modifying glucocorticoid receptor-regulated gene induction properties.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21153684 2011 Characterizing the novel protein p33MONOX.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...