Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Tick infestation 17 5.046 2.5

AA Sequence

MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGS      1 - 70
LIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYE     71 - 140
TCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW                                      141 - 176
//

Text Mined References (2)

PMID Year Title