Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tick infestation 16 5.065 2.5

AA Sequence

MALLLLSLGLSLIAAQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGS      1 - 70
LIFDFEYMVQGECVAVVVVCEKTEKNGEYSINYEGQNTVAVSETDYRLFITFHLQNFRNGTETHTLALYE     71 - 140
TCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW                                      141 - 176
//

Publication (2)

PMID Year Title
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.