Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.72

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Tick infestation 16 5.065 2.5

AA Sequence

TCEKYGLGSQNIIDLTNKDPCYSKHYRSPPRPPMRW                                      141 - 176

Text Mined References (2)

PMID Year Title
15363845 2004 Molecular evolution of epididymal lipocalin genes localized on mouse chromosome 2.
15164053 2004 DNA sequence and analysis of human chromosome 9.