Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.19
PubTator Score 12.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.678 2.5e-06
adult high grade glioma -1.500 3.0e-03
astrocytic glioma -2.200 1.9e-03
Breast cancer -2.100 1.4e-13
colon cancer -1.100 3.8e-02
ductal carcinoma in situ -1.200 5.6e-04
glioblastoma -2.000 2.2e-04
invasive ductal carcinoma -1.500 6.1e-03
lung carcinoma 1.900 5.5e-23
oligodendroglioma -1.600 4.3e-11
ovarian cancer -2.800 1.1e-13
pancreatic cancer -1.100 1.9e-04
pancreatic ductal adenocarcinoma liver m... -1.408 9.9e-03
Pick disease -1.400 9.2e-05
psoriasis -1.600 2.8e-04

Gene RIF (14)

AA Sequence

MSTAIREVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILISMMHPNKKYEEVPNIELNPMD      1 - 70
KFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFVGVVFKDSMSYELR     71 - 140
FFPDMIPVSSIYMDSRAGCSKSCEAAQYWSSGFTVLQASIDAAIIQLKTNVSLWKELESTKAVIMGETAV    141 - 210
VEIDTFPRGVILIYLVIAFSPFGYFLAIHIVAEKEKKIKEFLKIMGLHDTAFWLSWVLLYTSLIFLMSLL    211 - 280
MAVIATASLLFPQSSSIVIFLLFFLYGLSSVFFALMLTPLFKKSKHVGIVEFFVTVAFGFIGLMIILIES    281 - 350
FPKSLVWLFSPFCHCTFVIGIAQVMHLEDFNEGASFSNLTAGPYPLIITIIMLTLNSIFYVLLAVYLDQV    351 - 420
IPGEFGLRRSSLYFLKPSYWSKSKRNYEELSEGNVNGNISFSEIIEPVSSEFVGKEAIRISGIQKTYRKK    421 - 490
GENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASIYGHRVSEIDEMFEARKMIGI    491 - 560
CPQLDIHFDVLTVEENLSILASIKGIPANNIIQEVQKVLLDLDMQTIKDNQAKKLSGGQKRKLSLGIAVL    561 - 630
GNPKILLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSMFL    631 - 700
KSKWGIGYRLSMYIDKYCATESLSSLVKQHIPGATLLQQNDQQLVYSLPFKDMDKFSGLFSALDSHSNLG    701 - 770
VISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKAALVSTMSLW    771 - 840
KQQMYTIAKFHFFTLKRESKSVRSVLLLLLIFFTVQIFMFLVHHSFKNAVVPIKLVPDLYFLKPGDKPHK    841 - 910
YKTSLLLQNSADSDISDLISFFTSQNIMVTMINDSDYVSVAPHSAALNVMHSEKDYVFAAVFNSTMVYSL    911 - 980
PILVNIISNYYLYHLNVTETIQIWSTPFFQEITDIVFKIELYFQAALLGIIVTAMPPYFAMENAENHKIK    981 - 1050
AYTQLKLSGLLPSAYWIGQAVVDIPLFFIILILMLGSLLAFHYGLYFYTVKFLAVVFCLIGYVPSVILFT   1051 - 1120
YIASFTFKKILNTKEFWSFIYSVAALACIAITEITFFMGYTIATILHYAFCIIIPIYPLLGCLISFIKIS   1121 - 1190
WKNVRKNVDTYNPWDRLSVAVISPYLQCVLWIFLLQYYEKKYGGRSIRKDPFFRNLSTKSKNRKLPEPPD   1191 - 1260
NEDEDEDVKAERLKVKELMGCQCCEEKPSIMVSNLHKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILG   1261 - 1330
LLGPNGAGKSTIINILVGDIEPTSGQVFLGDYSSETSEDDDSLKCMGYCPQINPLWPDTTLQEHFEIYGA   1331 - 1400
VKGMSASDMKEVISRITHALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQITLLDEPSTGMDPKAKQH   1401 - 1470
MWRAIRTAFKNRKRAAILTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIEN   1471 - 1540
LEVDRLQREIQYIFPNASRQESFSSILAYKIPKEDVQSLSQSFFKLEEAKHAFAIEEYSFSQATLEQVFV   1541 - 1610
ELTKEQEEEDNSCGTLNSTLWWERTQEDRVVF                                         1611 - 1642
//

Text Mined References (21)

PMID Year Title