Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.05
PubTator Score 21.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 3.2e-03
gastric carcinoma -1.100 4.5e-03
interstitial cystitis -1.400 1.8e-02
invasive ductal carcinoma 1.300 9.6e-03
medulloblastoma, large-cell 1.400 7.7e-05

Gene RIF (7)

AA Sequence

MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDM      1 - 70
KNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWR     71 - 140
NFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGD    141 - 210
PSRHF                                                                     211 - 215
//

Text Mined References (17)

PMID Year Title