Property Summary

NCBI Gene PubMed Count 46
PubMed Score 26.92
PubTator Score 14.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 952 2.6e-06
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 3.346 1.7
Arthritis 290 3.06 1.5

Synonym

Accession Q8WWZ1 Q53SR9 Q56AT8 Q7RTZ5 Q969H5 Q9BYX1 IL-1F10
Symbols IL-38
FKSG75
IL1HY2
IL-1HY2
IL1-theta
FIL1-theta

Gene

PDB

5BOW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLAC      1 - 70
VETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEP     71 - 140
SARTKFYFEQSW                                                              141 - 152
//

Text Mined References (46)

PMID Year Title