Property Summary

NCBI Gene PubMed Count 41
PubMed Score 16.19
PubTator Score 14.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Atopic dermatitis 944 2.55803908558916E-6
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 3.361 1.7

Gene RIF (17)

PMID Text
26819499 results indicate that circulating IL-38 is a potentially novel biomarker for patients with ST-segment elevation myocardial infarction
26314375 Data suggest that IL-38 may be protective in SLE. A strong association between IL-38 and SLE severity suggests that IL-38 expression is driven by processes linked to SLE pathogenesis.
24969107 rs6759676, closest gene locus IL1F10 is associated with increased circulating levels of IL-1 receptor antagonist, a protective factor in development of insulin resistance.
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R]
22312160 The IL1A locus was strongly associated with alkylosing spondyloarthritis phenotype, whereas IL1F10 was associated with non-alkylosing spondyloarthritis.
20975573 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLAC      1 - 70
VETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEP     71 - 140
SARTKFYFEQSW                                                              141 - 152
//

Text Mined References (41)

PMID Year Title
26819499 2015 Elevated Plasma IL-38 Concentrations in Patients with Acute ST-Segment Elevation Myocardial Infarction and Their Dynamics after Reperfusion Treatment.
26314375 2015 Brief Report: Interleukin-38 Exerts Antiinflammatory Functions and Is Associated With Disease Activity in Systemic Lupus Erythematosus.
24969107 2014 Genetic determinants of circulating interleukin-1 receptor antagonist levels and their association with glycemic traits.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
22312160 2012 Association between the IL-1 family gene cluster and spondyloarthritis.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
20975573 2011 Interleukin 1 ? (IL-1B) and IL-1 antagonist receptor (IL-1RN) gene polymorphisms are associated with the genetic susceptibility and steroid dependence in patients with ulcerative colitis.
More...