Property Summary

NCBI Gene PubMed Count 41
PubMed Score 16.19
PubTator Score 14.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (17)

PMID Text
26819499 results indicate that circulating IL-38 is a potentially novel biomarker for patients with ST-segment elevation myocardial infarction
26314375 Data suggest that IL-38 may be protective in SLE. A strong association between IL-38 and SLE severity suggests that IL-38 expression is driven by processes linked to SLE pathogenesis.
24969107 rs6759676, closest gene locus IL1F10 is associated with increased circulating levels of IL-1 receptor antagonist, a protective factor in development of insulin resistance.
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R]
22312160 The IL1A locus was strongly associated with alkylosing spondyloarthritis phenotype, whereas IL1F10 was associated with non-alkylosing spondyloarthritis.
20975573 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLAC      1 - 70
VETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEP     71 - 140
SARTKFYFEQSW                                                              141 - 152
//

Publication (41)

PMID Year Title
26819499 2015 Elevated Plasma IL-38 Concentrations in Patients with Acute ST-Segment Elevation Myocardial Infarction and Their Dynamics after Reperfusion Treatment.
26314375 2015 Brief Report: Interleukin-38 Exerts Antiinflammatory Functions and Is Associated With Disease Activity in Systemic Lupus Erythematosus.
24969107 2014 Genetic determinants of circulating interleukin-1 receptor antagonist levels and their association with glycemic traits.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
22312160 2012 Association between the IL-1 family gene cluster and spondyloarthritis.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
20975573 2011 Interleukin 1 ? (IL-1B) and IL-1 antagonist receptor (IL-1RN) gene polymorphisms are associated with the genetic susceptibility and steroid dependence in patients with ulcerative colitis.
More...