Property Summary

NCBI Gene PubMed Count 40
PubMed Score 22.32
PubTator Score 64.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

AA Sequence

MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKK      1 - 70
TTFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLA     71 - 140
EGASLDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDA    141 - 210
LGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGK    211 - 280
CVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIK    281 - 350
LRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAH    351 - 420
PERPQLCRYDLVLMENVETVFQPILCPELQL                                           421 - 451
//

Text Mined References (40)

PMID Year Title