Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.23
PubTator Score 1.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 6.92742463755026E-13
psoriasis 6685 6.79956946355918E-10
osteosarcoma 7933 2.59421372038844E-8
medulloblastoma, large-cell 6234 7.68934212994589E-5
Atopic dermatitis 944 6.06592787188807E-4

Synonym

Accession Q8WWY7 Q5H980 Q9BR31
Symbols WAP2
SWAM2
C20orf122
dJ211D12.4

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
11779191 The size is 774 bp and it gives rise to a polypeptide of 111 amino acid residues that is homologous to elafin and similar WAP-type protease inhibitors.

AA Sequence

MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKC      1 - 70
VIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK                                  71 - 111
//

Text Mined References (6)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11779191 2002 Identification of a novel protease inhibitor gene that is highly expressed in the prostate.