Property Summary

NCBI Gene PubMed Count 83
PubMed Score 72.42
PubTator Score 182.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 3.9e-02
Gaucher disease type 1 -1.300 2.9e-02
group 3 medulloblastoma 1.200 6.6e-03
ovarian cancer 2.400 1.7e-07
psoriasis 2.700 6.6e-06

Protein-protein Interaction (11)

Gene RIF (58)

AA Sequence

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEY      1 - 70
ISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVK     71 - 140
ELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVES    141 - 210
RMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIV    211 - 280
QSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQ    281 - 350
RKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARI    351 - 420
SKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVK    421 - 490
GEKSGLMST                                                                 491 - 499
//

Text Mined References (90)

PMID Year Title