Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
R01 Count 3
Funding $177,958
PubMed Score 29.58
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
25578973 results evidence for the first time an increase of SELM expression in HCC liver tissues, and its gradual expression raise associated with an increased malignancy grade.
24332979 The aim of this study has been to analyze the structure-function relationships of SelM.
24284396 As Gal-1 plays important roles in preventing neurodegeneration and promoting neuroprotection in the brain, the interaction between SelM' and Gal-1 displays a new direction for studying the biological function of SelM in the human brain.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNL      1 - 70
VMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETS     71 - 140
DHADL                                                                     141 - 145
//

Publication (10)

PMID Year Title
25578973 2014 Assessment of the Selenoprotein M (SELM) over-expression on human hepatocellular carcinoma tissues by immunohistochemistry.
25416956 2014 A proteome-scale map of the human interactome network.
24332979 2014 Structure-function relationship and evolutionary history of the human selenoprotein M (SelM) found over-expressed in hepatocellular carcinoma.
24284396 2013 Galectin-1 is an interactive protein of selenoprotein M in the brain.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11839807 2002 Mammalian selenoprotein in which selenocysteine (Sec) incorporation is supported by a new form of Sec insertion sequence element.
10591208 1999 The DNA sequence of human chromosome 22.