Property Summary

NCBI Gene PubMed Count 9
PubMed Score 30.26
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.734 3.4e-02
acute quadriplegic myopathy 1.040 2.3e-03
adrenocortical carcinoma -1.133 2.8e-02
adult high grade glioma -2.300 7.1e-05
astrocytic glioma -2.000 8.5e-03
atypical teratoid / rhabdoid tumor -1.200 1.5e-03
ependymoma -2.100 7.5e-03
gastric carcinoma 1.400 2.7e-02
glioblastoma -1.300 1.3e-03
group 3 medulloblastoma -1.300 1.1e-02
intraductal papillary-mucinous carcinoma... -1.600 4.3e-03
intraductal papillary-mucinous neoplasm ... -1.600 3.3e-03
medulloblastoma, large-cell -3.300 2.2e-08
oligodendroglioma -1.600 3.9e-02
osteosarcoma 2.212 1.7e-03
ovarian cancer -1.600 8.1e-04
pancreatic cancer 1.300 8.7e-03
periodontitis 1.200 2.0e-22
primary pancreatic ductal adenocarcinoma 1.179 1.1e-02
primitive neuroectodermal tumor -1.700 2.2e-03
ulcerative colitis 1.900 1.2e-04

Gene RIF (3)

AA Sequence

MSLLLPPLALLLLLAALVAPATAATAYRPDWNRLSGLTRARVETCGGUQLNRLKEVKAFVTQDIPFYHNL      1 - 70
VMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETS     71 - 140
DHADL                                                                     141 - 145
//

Text Mined References (10)

PMID Year Title