Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 5
Funding $407,846
PubMed Score 43.52
PubTator Score 12.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18069935 SLC5A11 is involved with some immune effects and interacts with immune-related gene(s); it is consistent with its function as an autoimmune modifier gene.
18069935 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESGTSSPQPPQLDPLDAFPQKGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGDMVWWPV      1 - 70
GASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIR     71 - 140
IPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVIYTDALQTLI    141 - 210
MLIGALTLMGYSFAAVGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVLFGMSI    211 - 280
PSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKIC    281 - 350
SNPSGCSDIAYPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV    351 - 420
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLL    421 - 490
GLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVSWFTEPPSKEMVSHLTWFTRH    491 - 560
DPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEK    561 - 630
GKEELPARAEAIIVSLEENPLVKTLLDVNLIFCVSCAIFIWGYFA                             631 - 675
//

Publication (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18069935 2008 The sodium-dependent glucose cotransporter SLC5A11 as an autoimmune modifier gene in SLE.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15172003 2004 Spina bifida and genetic factors related to myo-inositol, glucose, and zinc.
More...