Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.77
PubTator Score 5.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-03
Astrocytoma, Pilocytic 1.300 1.2e-06
interstitial cystitis 1.600 1.1e-03
lung carcinoma -1.800 1.6e-28
non-small cell lung cancer -1.301 2.7e-25
osteosarcoma -2.740 5.9e-06

Synonym

Accession Q8WWW8 A6NHF8 E9PB44
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVIDLSECAVWKH      1 - 70
VGPSFVRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGHLEDGADSMESLSYTPSSLQP     71 - 140
SSASSLLTAHAASSSLPRDDPNTNAVATEETRSESELLFLPDYLVLSNCETGRLHHTSLPTRCDSWSNSD    141 - 210
RSLEQASFDDVFVDCLQPLPSSHLVHPSCHGSGAQEVPSSRPQAALIWSREINGPPRDHLSSSPLLESSL    211 - 280
SSTIQVDKNQGSLPCGAKELDIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDN    281 - 350
MRTWKADVEGQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNSG    351 - 420
SISSPLPELPANLEPPPVNRDLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPCSRTSFLSPERNGINS    421 - 490
ARFFANPVSREDEESYIEMEEHRTASSLSSGALTWTKKFSLDYLALDFNSASPAPMQQKLLLSEEQRVDY    491 - 560
VQVDEQKTQALQSTKQEWTDERQSKV                                                561 - 586
//

Text Mined References (18)

PMID Year Title