Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.76
PubTator Score 12.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
primary Sjogren syndrome 789
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
primary Sjogren syndrome 1.500 0.004
psoriasis -1.800 0.000

Gene RIF (10)

PMID Text
26138065 rs3125923 FCAMR gene represents a validated SNP to predict grade 3-4 Taxane-induced peripheral neuropathy . Genetically determined AA race represents the most significant predictor of TIPN.
25845491 A significantly worse survival was found in patients with IgA serum levels>2.85 g/l compared to patients with lower IgA serum levels.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20059578 ADAM10 and ADAM17 are involved in the shedding of FcalphaR
19945166 These results suggest that the cytoplasmic portion is required for the dimer formation and thus for efficient cell surface expression of Fcalpha/microR.
19682689 LPS, through the TLR4 receptor, activates the p38MAPK and NF-kappaB pathways and up-regulate the expression of Fcamr in human macrophages
19393604 the cytoplasmic portion of human Fcalpha/microR is required in the internalization.
19338768 These results indicate for the first time that Fcalpha/muR protein is expressed by human intestinal tissues
18379868 Comprehensive survey of naturally occurring polymorphisms in rhesus macaques and in humans.
8145026 Preincubation of monocytes with HIV-1 gp120 depresses anti-CD3 antibody-induced T cell stimulation and Fc receptor-mediated phagocytosis

AA Sequence

MPLFLILCLLQGSSFALPQKRPHPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLV      1 - 70
SGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRL     71 - 140
SQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPASTLPTATPAAGELTMRSYGTASPVANRWTPGTTQT    141 - 210
LGQGTAWDTVASTPGTSKTTASAEGRRTPGATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEG    211 - 280
VWEGTRSSVTNRARASKDRREMTTTKADRPREDIEGVRIALDAAKKVLGTIGPPALVSETLAWEILPQAT    281 - 350
PVSKQQSQGSIGETTPAAGMWTLGTPAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATGDRGPQATL    351 - 420
SQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTSQEAERVTLIQ    421 - 490
MTHFLEVNPQADQLPHVERKMLQDDSLPAGASLTAPERNPGP                                491 - 532
//

Text Mined References (14)

PMID Year Title
26138065 2015 Genome-Wide Association Studies for Taxane-Induced Peripheral Neuropathy in ECOG-5103 and ECOG-1199.
25845491 2015 Immunoglobulin A in serum: an old acquaintance as a new prognostic biomarker in idiopathic pulmonary fibrosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20059578 2010 Ectodomain shedding of Fcalpha receptor is mediated by ADAM10 and ADAM17.
19945166 2010 Requirement of the cytoplasmic portion for dimer formation of Fcalpha/micro receptor expressed on cell surface.
19682689 2010 Lipopolysaccharide up-regulates the expression of Fcalpha/mu receptor and promotes the binding of oxidized low-density lipoprotein and its IgM antibody complex to activated human macrophages.
19393604 2009 Cytoplasmic domain of human Fcalpha/mu receptor is required for ligand internalization.
19338768 2009 Human Fcalpha/muR and pIgR distribute differently in intestinal tissues.
18379868 2008 Human expression variation in the mu-opioid receptor is paralleled in rhesus macaque.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...