Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.33
PubTator Score 12.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-04
primary Sjogren syndrome 735 4.1e-03
Disease Target Count Z-score Confidence
ENSP00000256078 30 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
primary Sjogren syndrome 1.500 4.1e-03
psoriasis -1.800 1.3e-04

Gene RIF (11)

AA Sequence

MPLFLILCLLQGSSFALPQKRPHPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAAPNSLKGSRLV      1 - 70
SGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRL     71 - 140
SQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPASTLPTATPAAGELTMRSYGTASPVANRWTPGTTQT    141 - 210
LGQGTAWDTVASTPGTSKTTASAEGRRTPGATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEG    211 - 280
VWEGTRSSVTNRARASKDRREMTTTKADRPREDIEGVRIALDAAKKVLGTIGPPALVSETLAWEILPQAT    281 - 350
PVSKQQSQGSIGETTPAAGMWTLGTPAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATGDRGPQATL    351 - 420
SQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTSQEAERVTLIQ    421 - 490
MTHFLEVNPQADQLPHVERKMLQDDSLPAGASLTAPERNPGP                                491 - 532
//

Text Mined References (15)

PMID Year Title