Property Summary

NCBI Gene PubMed Count 11
PubMed Score 47.34
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.500 6.7e-03
astrocytic glioma -1.400 1.2e-02
ependymoma -1.300 3.6e-02
lung carcinoma 1.300 4.8e-28
oligodendroglioma -1.200 2.2e-02
osteosarcoma -1.820 1.6e-04
ovarian cancer 1.200 9.0e-04
pancreatic ductal adenocarcinoma liver m... -1.498 2.0e-02

Gene RIF (4)

AA Sequence

MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHY      1 - 70
PNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG     71 - 140
DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLI    141 - 210
LGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGS    211 - 280
TETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCL    281 - 350
DDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV                            351 - 396
//

Text Mined References (13)

PMID Year Title