Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
R01 Count 3
Funding $37,320
PubMed Score 43.02
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 0.012
ependymoma -1.300 0.036
oligodendroglioma -1.200 0.022
osteosarcoma -1.820 0.000
pancreatic ductal adenocarcinoma liver m... -1.498 0.020
lung carcinoma 1.300 0.000
acute myeloid leukemia -1.500 0.007
ovarian cancer 1.200 0.001

Synonym

Accession Q8WWV3 Q8N9B3 Q8WZ66 Q9BRA4
Symbols NIMP
OPA10

Gene

PANTHER Protein Class (2)

PDB

2VN8  

Gene RIF (4)

PMID Text
26593267 Recessive Mutations in RTN4IP1 Cause Isolated and Syndromic Optic Neuropathies.
23393170 RTN4IP1 has a tumor-suppressive function and may regulate thyroid cancer progression.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHY      1 - 70
PNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG     71 - 140
DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLI    141 - 210
LGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGS    211 - 280
TETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCL    281 - 350
DDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV                            351 - 396
//

Text Mined References (13)

PMID Year Title
26593267 2015 Recessive Mutations in RTN4IP1 Cause Isolated and Syndromic Optic Neuropathies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23393170 2013 RTN4IP1 is down-regulated in thyroid cancer and has tumor-suppressive function.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...