Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $795,212.01
PubMed Score 7.85
PubTator Score 36.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -4.000 0.000
lung carcinoma -1.100 0.000
non-small cell lung carcinoma -1.100 0.000

Gene RIF (4)

PMID Text
23643964 Studies indicate that ITLN1 and ITLN2 intelectins are positioned on a single chromosome 1, suggesting mammalian intelectins have been independently expanded by partial gene duplication.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSMLRTMTRLCFLLFFSVATSGCSAAAASSLEMLSREFETCAFSFSSLPRSCKEIKERCHSAGDGLYFL      1 - 70
RTKNGVVYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEA     71 - 140
ATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSALLRYRTNTGFLQRLGHNLFGIYQKYPVKYRSGK    141 - 210
CWNDNGPAIPVVYDFGDAKKTASYYSPYGQREFVAGFVQFRVFNNERAANALCAGIKVTGCNTEHHCIGG    211 - 280
GGFFPQGKPRQCGDFSAFDWDGYGTHVKSSCSREITEAAVLLFYR                             281 - 325
//

Text Mined References (10)

PMID Year Title
23643964 2013 Comparative genomic and phylogenetic analyses of the intelectin gene family: implications for their origin and evolution.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181563 2001 Human homologs of the Xenopus oocyte cortical granule lectin XL35.