Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.69
PubTator Score 36.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 1.3e-25
lung adenocarcinoma 2716 2.7e-19
lung carcinoma 2843 2.4e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Viral encephalitis 2 3.54 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.900 2.7e-19
lung carcinoma -1.100 2.4e-08
non-small cell lung carcinoma -1.100 1.3e-25

Gene RIF (4)

AA Sequence

MLSMLRTMTRLCFLLFFSVATSGCSAAAASSLEMLSREFETCAFSFSSLPRSCKEIKERCHSAGDGLYFL      1 - 70
RTKNGVVYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEA     71 - 140
ATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSALLRYRTNTGFLQRLGHNLFGIYQKYPVKYRSGK    141 - 210
CWNDNGPAIPVVYDFGDAKKTASYYSPYGQREFVAGFVQFRVFNNERAANALCAGIKVTGCNTEHHCIGG    211 - 280
GGFFPQGKPRQCGDFSAFDWDGYGTHVKSSCSREITEAAVLLFYR                             281 - 325
//

Text Mined References (10)

PMID Year Title