Property Summary

NCBI Gene PubMed Count 10
PubMed Score 18.05
PubTator Score 21.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
spina bifida 1074 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Uterine carcinosarcoma 3 3.654 1.8
Infertility 188 3.256 1.6
Varicocele 26 3.202 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -1.297 1.8e-02

Gene RIF (3)

AA Sequence

MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVTGLTETVNEVSKLSNKIGMNCDYYM      1 - 70
EEKVLPPSSLEGKVKETVHNAFWDHLKEQLSATPPDFSCALELLKEIKEILLSLLLPRQNRLRIEIEEAL     71 - 140
DMDLLKQEAEHGALKVLYLSKYVLNMMALLCAPVRDEAVQKLENITDPVWLLRGIFQVLGRMKMDMVNYT    141 - 210
IQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGDLTMSPPTCPDTSDSSSVAGPSPNEAA    211 - 280
NNPEPLSPTMVLCQGFLNLLLWDLENEEFPETLLMDRTRLQELKSQLHQLTVMASVLLVASSFSGSVLFG    281 - 350
SPQFVDKLKRITKSLLEDFHSRPEEAILTVSEQVSQEIHQSLKNMGLVALSSDNTASLMGQLQNIAKKEN    351 - 420
CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLI    421 - 490
SPAQALETKVESV                                                             491 - 503
//

Text Mined References (13)

PMID Year Title