Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $193,641.5
PubMed Score 17.96
PubTator Score 21.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -1.297 0.018

Synonym

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (3)

PMID Text
21597245 These results suggest that TCP11 may be responsible for sperm tail morphology and motility.
20546612 Observational study of gene-disease association. (HuGE Navigator)
11756566 Results suggest that TCP11 gene is important in sperm function and fertility.

AA Sequence

MPDVKESVPPKYPGDSEGRSCKPETSGPPQEDKSGSEDPPPFLSVTGLTETVNEVSKLSNKIGMNCDYYM      1 - 70
EEKVLPPSSLEGKVKETVHNAFWDHLKEQLSATPPDFSCALELLKEIKEILLSLLLPRQNRLRIEIEEAL     71 - 140
DMDLLKQEAEHGALKVLYLSKYVLNMMALLCAPVRDEAVQKLENITDPVWLLRGIFQVLGRMKMDMVNYT    141 - 210
IQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGDLTMSPPTCPDTSDSSSVAGPSPNEAA    211 - 280
NNPEPLSPTMVLCQGFLNLLLWDLENEEFPETLLMDRTRLQELKSQLHQLTVMASVLLVASSFSGSVLFG    281 - 350
SPQFVDKLKRITKSLLEDFHSRPEEAILTVSEQVSQEIHQSLKNMGLVALSSDNTASLMGQLQNIAKKEN    351 - 420
CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLI    421 - 490
SPAQALETKVESV                                                             491 - 503
//

Publication (13)

PMID Year Title
21597245 2011 Human t-complex protein 11 (TCP11), a testis-specific gene product, is a potential determinant of the sperm morphology.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
18391951 2008 Many sequence variants affecting diversity of adult human height.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12905703 2003 [Cloning, expression, and alternative splicing of the novel isoform of hTCP11 gene].
12545228 2003 [Cloning, expression and alternative splicing of a novel isoform of human TCP11b gene].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756566 2002 Molecular characterization of the TCP11 gene which is the human homologue of the mouse gene encoding the receptor of fertilization promoting peptide.
More...