Tbio | Solute carrier family 13 member 3 |
High-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-5 carbon atoms. The stoichiometry is probably 3 Na(+) for 1 divalent succinate.
Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet. [provided by RefSeq, Jul 2008]
Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Chronic Kidney Diseases | 22 |
Glomerular filtration rate finding | 2 |
Disease | Target Count | P-value |
---|---|---|
medulloblastoma, large-cell | 6234 | 8.47504497730539E-7 |
sonic hedgehog group medulloblastoma | 1482 | 3.95192030928992E-5 |
osteosarcoma | 7933 | 4.23161022141951E-4 |
nephrosclerosis | 329 | 0.0103234921174129 |
gastric carcinoma | 832 | 0.0107679482123104 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Canavan disease | 11 | 3.756 | 1.9 |
Diastrophic dysplasia | 21 | 3.375 | 1.7 |
Axenfeld-Rieger syndrome | 11 | 3.345 | 1.7 |
Disease | log2 FC | p |
---|---|---|
nephrosclerosis | -1.923 | 0.010 |
osteosarcoma | 1.123 | 0.000 |
medulloblastoma, large-cell | 1.500 | 0.000 |
sonic hedgehog group medulloblastoma | -1.200 | 0.000 |
gastric carcinoma | -1.200 | 0.011 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
25354943 | OAT1 and NaDC3 in the basolateral membrane and OAT4 in the luminal membrane of proximal tubule cells are responsible for the avid renal secretion of N-carbamoylglutamate. |
24667918 | Microarray analysis indicates HIV-1 Tat-induced upregulation of solute carrier family 13, member 3 (SLC13A3; sodium-dependent dicarboxylate transporter) in primary human brain microvascular endothelial cells |
24351856 | In a study addressing genetic, social, and environmental contributors of chronic kidney disease with tubulointerstitial damages in Sri Lanka, SNP rs6066043 of SLC13A3 was found attributable risk of 50%. |
24247155 | study concludes NaDC3 present at the basolateral membrane of proximal tubule cells mediates sodium-dependent glutathione (GSH) uptake; the kinetic data show that NaDC3 is a low-affinity GSH transporter |
21873665 | The results indicate that SLC13A3 is a direct downstream target of PITX2 transcriptional regulation and that levels of PITX2 and SLC13A3 modulate responses to oxidative stress in ocular cells. |
21865262 | The data 1) reveal alpha-ketoglutarate as a common high-affinity substrate of NaDC3, OAT1, and OAT3 |
20813124 | NaDC3 promotes cellular senescence probably by inhibiting NAD(+)-dependent SIRT1. |
18602983 | Observational study of gene-disease association. (HuGE Navigator) |
16331647 | We provide direct evidence of the localization of NaDC3 at the basolateral membrane of human renal proximal tubule cells and identify a di-hydrophobic amino acid motif VW as basolateral localization signal in the N-terminal cytoplasmic domain of NaDC3. |
15561973 | The narrow substrate specificity prevents interaction of drugs with dicarboxylate-like structure with hNaDC-3 and ensures sufficient support of the proximal tubule cells with alpha-ketoglutarate for anion secretion via organic anion transporter 1 or 3. |
MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLSVTALLPIVLF 1 - 70 PFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSM 71 - 140 WLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGET 141 - 210 EVPLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFI 211 - 280 FAFPLMLLFLLAGWLWISFLYGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFC 281 - 350 MFAILLFTRDPKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK 351 - 420 AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIII 421 - 490 FLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS 491 - 560 LAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL 561 - 602 //
PMID | Year | Title |
---|---|---|
25354943 | 2014 | Transporters involved in renal excretion of N-carbamoylglutamate, an orphan drug to treat inborn n-acetylglutamate synthase deficiency. |
24351856 | 2014 | An integrative study of the genetic, social and environmental determinants of chronic kidney disease characterized by tubulointerstitial damages in the North Central Region of Sri Lanka. |
24247155 | 2013 | Glutathione is a low-affinity substrate of the human sodium-dependent dicarboxylate transporter. |
21873665 | 2011 | PITX2 is involved in stress response in cultured human trabecular meshwork cells through regulation of SLC13A3. |
21865262 | 2011 | Differential interaction of dicarboxylates with human sodium-dicarboxylate cotransporter 3 and organic anion transporters 1 and 3. |
20813124 | 2010 | High-affinity Na(+)-dependent dicarboxylate cotransporter promotes cellular senescence by inhibiting SIRT1. |
19056867 | 2009 | Large-scale proteomics and phosphoproteomics of urinary exosomes. |
18602983 | 2008 | Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
More... |