Property Summary

NCBI Gene PubMed Count 22
Grant Count 12
R01 Count 8
Funding $1,165,934.23
PubMed Score 26.71
PubTator Score 29.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis -1.923 0.010
osteosarcoma 1.123 0.000
medulloblastoma, large-cell 1.500 0.000
sonic hedgehog group medulloblastoma -1.200 0.000
gastric carcinoma -1.200 0.011

Gene RIF (10)

PMID Text
25354943 OAT1 and NaDC3 in the basolateral membrane and OAT4 in the luminal membrane of proximal tubule cells are responsible for the avid renal secretion of N-carbamoylglutamate.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of solute carrier family 13, member 3 (SLC13A3; sodium-dependent dicarboxylate transporter) in primary human brain microvascular endothelial cells
24351856 In a study addressing genetic, social, and environmental contributors of chronic kidney disease with tubulointerstitial damages in Sri Lanka, SNP rs6066043 of SLC13A3 was found attributable risk of 50%.
24247155 study concludes NaDC3 present at the basolateral membrane of proximal tubule cells mediates sodium-dependent glutathione (GSH) uptake; the kinetic data show that NaDC3 is a low-affinity GSH transporter
21873665 The results indicate that SLC13A3 is a direct downstream target of PITX2 transcriptional regulation and that levels of PITX2 and SLC13A3 modulate responses to oxidative stress in ocular cells.
21865262 The data 1) reveal alpha-ketoglutarate as a common high-affinity substrate of NaDC3, OAT1, and OAT3
20813124 NaDC3 promotes cellular senescence probably by inhibiting NAD(+)-dependent SIRT1.
18602983 Observational study of gene-disease association. (HuGE Navigator)
16331647 We provide direct evidence of the localization of NaDC3 at the basolateral membrane of human renal proximal tubule cells and identify a di-hydrophobic amino acid motif VW as basolateral localization signal in the N-terminal cytoplasmic domain of NaDC3.
15561973 The narrow substrate specificity prevents interaction of drugs with dicarboxylate-like structure with hNaDC-3 and ensures sufficient support of the proximal tubule cells with alpha-ketoglutarate for anion secretion via organic anion transporter 1 or 3.

AA Sequence

MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLSVTALLPIVLF      1 - 70
PFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSM     71 - 140
WLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGET    141 - 210
EVPLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFI    211 - 280
FAFPLMLLFLLAGWLWISFLYGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFC    281 - 350
MFAILLFTRDPKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK    351 - 420
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIII    421 - 490
FLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS    491 - 560
LAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL                                561 - 602
//

Publication (24)

PMID Year Title
25354943 2014 Transporters involved in renal excretion of N-carbamoylglutamate, an orphan drug to treat inborn n-acetylglutamate synthase deficiency.
24351856 2014 An integrative study of the genetic, social and environmental determinants of chronic kidney disease characterized by tubulointerstitial damages in the North Central Region of Sri Lanka.
24247155 2013 Glutathione is a low-affinity substrate of the human sodium-dependent dicarboxylate transporter.
21873665 2011 PITX2 is involved in stress response in cultured human trabecular meshwork cells through regulation of SLC13A3.
21865262 2011 Differential interaction of dicarboxylates with human sodium-dicarboxylate cotransporter 3 and organic anion transporters 1 and 3.
20813124 2010 High-affinity Na(+)-dependent dicarboxylate cotransporter promotes cellular senescence by inhibiting SIRT1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...