Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.66
PubTator Score 29.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
gastric carcinoma -1.200 1.1e-02
medulloblastoma, large-cell 1.500 8.5e-07
nephrosclerosis -1.923 1.0e-02
osteosarcoma 1.123 4.2e-04
sonic hedgehog group medulloblastoma -1.200 4.0e-05

Gene RIF (11)

AA Sequence

MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLSVTALLPIVLF      1 - 70
PFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSM     71 - 140
WLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGET    141 - 210
EVPLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFI    211 - 280
FAFPLMLLFLLAGWLWISFLYGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFC    281 - 350
MFAILLFTRDPKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK    351 - 420
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIII    421 - 490
FLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS    491 - 560
LAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL                                561 - 602
//

Text Mined References (25)

PMID Year Title