Property Summary

Ligand Count 3
NCBI Gene PubMed Count 22
PubMed Score 25.11
PubTator Score 19.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 3.3e-05
psoriasis 6694 3.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Glycoproteinosis 12 5.527 2.8

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 3.3e-05
psoriasis -1.300 3.6e-04

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGA      1 - 70
LHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSAR     71 - 140
DLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWR    141 - 210
CGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSI    211 - 280
VGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPR    281 - 350
PGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS    351 - 420
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS          421 - 484
//

Text Mined References (22)

PMID Year Title