Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.14
PubTator Score 19.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.300 0.000
psoriasis -1.300 0.000

Synonym

Accession Q8WWR8 A8K056 J3KNJ5 Q96D64
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
25144716 The silencing or chemical inhibition of NEU4 changes the entire glycosylation pattern of proteins and lipids, making it more similar to that of differentiated GBM cells and drastically reduces GSCs survival.
24030392 The results demonstrate that the proline-rich region can also enhance cell proliferation and retinoic acid (RA)-induced neuronal differentiation and it is also involved in NEU4 interaction with Akt.
22393058 NEU4 is involved in regulation of neuronal function by polySia degradation in mammals.
22287118 Overexpression of NEU4 is associated with neuroblastoma.
21521691 NEU4 plays an important role in control of sialyl Lewis antigen expression and its impairment in colon cancer
19797320 The NEU4 long form localizes in mitochondria, while the short form is also associated with the endoplasmic reticulum.
18651674 related to malignancy and may be potential targets for cancer diagnosis and therapy
15885103 Data show that the differentiation of monocytes into macrophages is associated with regulation of the expression of at least three distinct cellular sialidases, Neu1, 3, and 4, with specific up-regulation of the enzyme activity of only Neu1.
15213228 Neu4 is a novel human lysosomal lumen sialidase
14962670 The NEU4 gene, identified by searching sequence databases for entries showing homologies to the human cytosolic sialidase NEU2, maps in 2q37 and encodes a 484-residue protein.

AA Sequence

MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGTLAGGSVRWGA      1 - 70
LHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSAR     71 - 140
DLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWR    141 - 210
CGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSI    211 - 280
VGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPR    281 - 350
PGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS    351 - 420
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS          421 - 484
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25144716 2014 Sialidase NEU4 is involved in glioblastoma stem cell survival.
24030392 2013 A proline-rich loop mediates specific functions of human sialidase NEU4 in SK-N-BE neuronal differentiation.
22393058 2012 Sialidase NEU4 hydrolyzes polysialic acids of neural cell adhesion molecules and negatively regulates neurite formation by hippocampal neurons.
22287118 2012 NEU4L sialidase overexpression promotes ?-catenin signaling in neuroblastoma cells, enhancing stem-like malignant cell growth.
21521691 2011 Regulation of sialyl Lewis antigen expression in colon cancer cells by sialidase NEU4.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19797320 2010 Human sialidase NEU4 long and short are extrinsic proteins bound to outer mitochondrial membrane and the endoplasmic reticulum, respectively.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19060904 2009 An empirical framework for binary interactome mapping.
More...