Property Summary

NCBI Gene PubMed Count 34
Grant Count 33
R01 Count 5
Funding $18,325,414.22
PubMed Score 586.80
PubTator Score 61.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (24)

PMID Text
25446080 HARE/Stabilin-2 splice variants are expressed in bone marrow, lymph node, and spleen
24942734 a Link domain complex N-glycan is required specifically for HARE.hyaluronic acid-mediated activation of ERK1/2 and NF-kappaB-mediated gene expression
24247245 HARE may be part of a systemic tissue-stress sensor feedback system that responds to abnormal tissue turnover or damage as a danger signal
23870052 Loss of Stabilin-2 expression in peri-tumourous transdifferentiated liver endothelial cells correlates with increased survival by preventing endothelial-tumour cell adhesive interactions and microvascular invasion.
23530033 Hyaluronan binding to HARE mediates NF-kappaB-activated gene expression in a dose-dependent manner.
23416077 stabilin-2 acts as a receptor for necrotic cell clearance.
22566688 knockdown of endogenous alphavbeta5 expression or treatment with a function-blocking alphavbeta5 antibody significantly decreased stabilin-2-mediated phagocytosis in the absence of soluble factors
22052472 Ligament Flavum (LF) hypertrophy is accompanied by increased CD44 and CD44v5 expression. CD44v6 expression is not enhanced in LF hypertrophy.
21029358 Observational study of gene-disease association. (HuGE Navigator)
20466649 The results indicate that Link domain N-glycans stabilize interactions that facilitate HA binding to HARE.
More...

AA Sequence

MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTMITSGSVGVRD      1 - 70
CRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPCNGRGSCAEGMEGNGTCSCQE     71 - 140
GFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGTCECYSAYTGPKCDKPIPECAALLCPENSRC    141 - 210
SPSTEDENKLECKCLPNYRGDGKYCDPINPCLRKICHPHAHCTYLGPNRHSCTCQEGYRGDGQVCLPVDP    211 - 280
CQINFGNCPTKSTVCKYDGPGQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANCTTVAPGRTECIC    281 - 350
QKGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNV    351 - 420
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIFNSDKDNQIKLKLHGGKKKVKIIQGD    421 - 490
IIASNGLLHILDRAMDKLEPTFESNNEQTIMTMLQPRYSKFRSLLEETNLGHALDEDGVGGPYTIFVPNN    491 - 560
EALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVATLISTPHIRSMANQLIQFNTTDNGQILAND    561 - 630
VAMEEIEITAKNGRIYTLTGVLIPPSIVPILPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTH    631 - 700
RCVYSGRFGSLKSGCARYCNATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGF    701 - 770
QGSQCQFCSDPNKYGPRCNKKCLCVHGTCNNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHIH    771 - 840
ATCEYSNGTASCICKAGYEGDGTLCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQGWTGNGRDCSE    841 - 910
INNCLLPSAGGCHDNASCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQTGKCHPLASCQSTSSGVWSC    911 - 980
VCQEGYEGDGFLCYGNAAVELSFLSEAAIFNRWINNASLQPTLSATSNLTVLVPSQQATEDMDQDEKSFW    981 - 1050
LSQSNIPALIKYHMLLGTYRVADLQTLSSSDMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVI   1051 - 1120
HIINKVLVPQRRLTGSLPNLLMRLEQMPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKK   1121 - 1190
VLSLEEDVLRYHVVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHG   1191 - 1260
LGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRT   1261 - 1330
VITRECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEGFSGTACETCTEGKYGIHCDQACS   1331 - 1400
CVHGRCNQGPLGDGSCDCDVGWRGVHCDNATTEDNCNGTCHTSANCLTNSDGTASCKCAAGFQGNGTICT   1401 - 1470
AINACEISNGGCSAKADCKRTTPGRRVCTCKAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAAC   1471 - 1540
NCLPAYTGDGKVCTLINVCLTKNGGCSEFAICNHTGQVERTCTCKPNYIGDGFTCRGSIYQELPKNPKTS   1541 - 1610
QYFFQLQEHFVKDLVGPGPFTVFAPLSAAFDEEARVKDWDKYGLMPQVLRYHVVACHQLLLENLKLISNA   1611 - 1680
TSLQGEPIVISVSQSTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDNSGRILQNLTTLATN   1681 - 1750
NGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDQALHALPAEQQDFLFNQDNKDKLKEYLKFHVIRDAK   1751 - 1820
VLAVDLPTSTAWKTLQGSELSVKCGAGRDIGDLFLNGQTCRIVQRELLFDLGVAYGIDCLLIDPTLGGRC   1821 - 1890
DTFTTFDASGECGSCVNTPSCPRWSKPKGVKQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQ   1891 - 1960
ACPGGPDAPCNNRGVCLDQYSATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQC   1961 - 2030
LCETGWTGPSCDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS   2031 - 2100
QKGTKVSCSCQKGYKGDGHSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYVGDGLNCEPEQLP   2101 - 2170
IDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAREACANEAATMATYNQLSYAQKAK   2171 - 2240
YHLCSAGWLETGRVAYPTAFASQNCGSGVVGIVDYGPRPNKSEMWDVFCYRMKDVNCTCKVGYVGDGFSC   2241 - 2310
SGNLLQVLMSFPSLTNFLTEVLAYSNSSARGRAFLEHLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHL   2311 - 2380
ANVSMFFYNDLVNGTTLQTRLGSKLLITASQDPLQPTETRFVDGRAILQWDIFASNGIIHVISRPLKAPP   2381 - 2450
APVTLTHTGLGAGIFFAIILVTGAVALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYE   2451 - 2520
STTSAPPEPSYDPFTDSEERQLEGNDPLRTL                                          2521 - 2551
//

Text Mined References (37)

PMID Year Title
25446080 2015 Tissue-specific splice variants of HARE/Stabilin-2 are expressed in bone marrow, lymph node, and spleen.
24942734 2014 A hyaluronan receptor for endocytosis (HARE) link domain N-glycan is required for extracellular signal-regulated kinase (ERK) and nuclear factor-?B (NF-?B) signaling in response to the uptake of hyaluronan but not heparin, dermatan sulfate, or acetylated low density lipoprotein (LDL).
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247245 2014 Hyaluronic acid receptor for endocytosis (HARE)-mediated endocytosis of hyaluronan, heparin, dermatan sulfate, and acetylated low density lipoprotein (AcLDL), but not chondroitin sulfate types A, C, D, or E, activates NF-?B-regulated gene expression.
23870052 2013 Endothelial transdifferentiation in hepatocellular carcinoma: loss of Stabilin-2 expression in peri-tumourous liver correlates with increased survival.
23530033 2013 The hyaluronan receptor for endocytosis (HARE) activates NF-?B-mediated gene expression in response to 40-400-kDa, but not smaller or larger, hyaluronans.
23416077 2013 Stabilin-2 acts as an engulfment receptor for the phosphatidylserine-dependent clearance of primary necrotic cells.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22566688 2012 Cross talk between engulfment receptors stabilin-2 and integrin ?v?5 orchestrates engulfment of phosphatidylserine-exposed erythrocytes.
More...