Property Summary

NCBI Gene PubMed Count 36
PubMed Score 326.36
PubTator Score 75.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.300 1.0e-06
invasive ductal carcinoma -1.810 3.3e-05
psoriasis -1.100 3.4e-29

Gene RIF (25)

AA Sequence

MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTLILLDVSTKNP      1 - 70
VRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGP     71 - 140
DYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKL    141 - 210
YNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLG    211 - 280
KDYIQLKSLLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLK    281 - 350
TRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR    351 - 420
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNH    421 - 490
NYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSVQLNGQPLVMVDDGTLPELKP    491 - 560
RPLRAGRTLVIPPVTMGFYVVKNVNALACRYR                                          561 - 592
//

Text Mined References (35)

PMID Year Title