Property Summary

NCBI Gene PubMed Count 33
Grant Count 9
R01 Count 5
Funding $1,163,542
PubMed Score 286.76
PubTator Score 75.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma -1.810 0.000
non-inflammatory breast cancer -1.400 0.000
psoriasis -1.100 0.000

Gene RIF (22)

PMID Text
26084486 Our findings identified these 2 genes as a novel breast cancer biomarker gene set, which may facilitate the diagnosis and treatment in breast cancer clinical therapies.
25924634 HPSE2 mutations were found in one Urofacial syndrome family but not detected in patients with non-neurogenic neurogenic bladder and severe lower urinary tract dysfunction
25423319 Heparanase 2 is more intensely expressed in the glandular tissue of cancer than in nonneoplastic endometrium; the HPSE2 expression in the stromal tissue is higher in the nonneoplastic controls compared with cancer mainly in the secretory endometrium.
25145936 autonomic neural protein implicated in bladder emptying
24139593 High expression of heparanase-2 is associated significantly with gastric tumor growth and differentiation
23370684 Data indicate that the overexpression of HPSE1 and HPSE2 in the intervertebral degenerated discs suggests a role for these factors in mediating extracellular matrix remodeling in degenerative discs during disease development.
21450525 A large region of marker homozygosity was observed at 10q24, consistent with known autosomal recessive inheritance, family consanguinity and previous genetic mapping in other families with Ochoa syndrome.
21332471 HPSE2 c.631T>C (p.Y211H) is a novel benign SNP and c.1628A>T (p.N543I) is the disease-causing mutation in urofacial syndrome.
21308479 Studies indicate that cathepsin L as the heparanase activating protease.
20560210 Homozygous exonic deletions, nonsense mutations, and frameshift mutations in five further unrelated families confirmed HPSE2 as the causative gene for UFS
More...

AA Sequence

MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTLILLDVSTKNP      1 - 70
VRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGP     71 - 140
DYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKL    141 - 210
YNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLG    211 - 280
KDYIQLKSLLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLK    281 - 350
TRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR    351 - 420
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNH    421 - 490
NYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSVQLNGQPLVMVDDGTLPELKP    491 - 560
RPLRAGRTLVIPPVTMGFYVVKNVNALACRYR                                          561 - 592
//

Text Mined References (32)

PMID Year Title
26084486 2015 Gene expression profiling leads to discovery of correlation of matrix metalloproteinase 11 and heparanase 2 in breast cancer progression.
25924634 2015 HPSE2 mutations in urofacial syndrome, non-neurogenic neurogenic bladder and lower urinary tract dysfunction.
25423319 2015 Immunohistochemical expression of heparanases 1 and 2 in benign tissue and in invasive neoplasia of the endometrium: a case-control study.
25145936 2015 Urinary tract effects of HPSE2 mutations.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24139593 2013 High expression of heparanase-2 is an independent prognostic parameter for favorable survival in gastric cancer patients.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23370684 2013 Expression of heparanase isoforms in intervertebral discs classified according to Pfirrmann grading system for disc degeneration.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...