Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.27
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WWP7 B2RCI3 Q8NAZ0
Symbols IAN2
IMAP1
HIMAP1
IMAP38

Gene

PDB

3V70  

Gene RIF (4)

PMID Text
24626161 GIMAP1 and SERHL variants may be important for appendicular lean mass
20194894 Shows a critical role for the related mouse gene in mature lymphocyte development and survival.
18701445 GIMAP1 and GIMAP4 genes are up-regulated by IL-12 and other Th1 differentiation-inducing cytokines in cells induced to differentiate toward Th1 lineage and down-regulated by IL-4 in cells induced to Th2.
11814688 The himap1 gene belongs to a gene family clustered on chromosome 7q32-36 within a region highly syntenic to the mouse imap38 locus on chromosome 6B.

AA Sequence

MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGATSVTRACTTGS      1 - 70
RRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQLGRFTAQDQQAVRQVRDMFG     71 - 140
EDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEG    141 - 210
LVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL    211 - 280
LLGGALLFWVLLHRRWSEAVAEVGPD                                                281 - 306
//

Publication (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24626161 2014 Genome-wide association study identified copy number variants important for appendicular lean mass.
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20194894 2010 Putative GTPase GIMAP1 is critical for the development of mature B and T lymphocytes.
18701445 2009 Quantitative proteomics reveals GIMAP family proteins 1 and 4 to be differentially regulated during human T helper cell differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...