Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.27
PubTator Score 9.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.33196635154474E-20
non-small cell lung cancer 2798 3.82724076054681E-20
lung carcinoma 2844 4.44550912547109E-7
medulloblastoma, large-cell 6234 5.97269720963057E-7
hepatocellular carcinoma 550 1.92190042529119E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.236589788794E-5
breast carcinoma 1614 1.08274026638013E-4
ovarian cancer 8492 1.20471237332523E-4
interstitial cystitis 2299 1.50222637997986E-4
osteosarcoma 7933 2.77034184540801E-4
invasive ductal carcinoma 2950 5.55966846076802E-4
ductal carcinoma in situ 1745 6.37669255341379E-4
ulcerative colitis 2087 9.29752881016002E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0012455234555751
primary Sjogren syndrome 789 0.00155863856200658
tuberculosis and treatment for 6 months 686 0.00237318896918852
group 4 medulloblastoma 1875 0.00244338273405116
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00277954318240984
gastric cancer 436 0.00651146506881201
atypical teratoid / rhabdoid tumor 4369 0.00830713212088596
pancreatic cancer 2300 0.00837823124327799
pancreatic carcinoma 567 0.00837823124327799
Pick disease 1893 0.0109988132012135
Breast cancer 3099 0.0320091733426168
Disease Target Count Z-score Confidence
Lymphopenia 35 3.345 1.7

Expression

Synonym

Accession Q8WWP7 B2RCI3 Q8NAZ0
Symbols IAN2
IMAP1
HIMAP1
IMAP38

Gene

PDB

3V70  

  Ortholog (7)

Gene RIF (4)

PMID Text
24626161 GIMAP1 and SERHL variants may be important for appendicular lean mass
20194894 Shows a critical role for the related mouse gene in mature lymphocyte development and survival.
18701445 GIMAP1 and GIMAP4 genes are up-regulated by IL-12 and other Th1 differentiation-inducing cytokines in cells induced to differentiate toward Th1 lineage and down-regulated by IL-4 in cells induced to Th2.
11814688 The himap1 gene belongs to a gene family clustered on chromosome 7q32-36 within a region highly syntenic to the mouse imap38 locus on chromosome 6B.

AA Sequence

MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQRRFFSRLGATSVTRACTTGS      1 - 70
RRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLLSAPGPHALLLVTQLGRFTAQDQQAVRQVRDMFG     71 - 140
EDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEG    141 - 210
LVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL    211 - 280
LLGGALLFWVLLHRRWSEAVAEVGPD                                                281 - 306
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24626161 2014 Genome-wide association study identified copy number variants important for appendicular lean mass.
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20194894 2010 Putative GTPase GIMAP1 is critical for the development of mature B and T lymphocytes.
18701445 2009 Quantitative proteomics reveals GIMAP family proteins 1 and 4 to be differentially regulated during human T helper cell differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...