Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.87
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 0.002
posterior fossa group A ependymoma -4.400 0.000
oligodendroglioma -2.800 0.010
cutaneous lupus erythematosus 1.500 0.025
glioblastoma -4.700 0.000
osteosarcoma -3.225 0.000
medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -5.200 0.000
primitive neuroectodermal tumor -5.100 0.000
lung cancer -1.800 0.000
adult high grade glioma -3.700 0.000
pilocytic astrocytoma -3.600 0.000
pituitary cancer 2.300 0.000
Down syndrome -1.100 0.001

Gene RIF (7)

PMID Text
22085542 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016009 protein-protein interaction mediated by ARNO coiled-coil domain required for ARNO induced motility; coiled-coil domain promotes assembly of multiprotein complex containing ARNO and Dock180; assembly of complex requires coiled-coil domain, GRASP and IPCEF
19913121 Observational study of gene-disease association. (HuGE Navigator)
17067457 PTEN may down-regulate the expression of PIP3, and then down-regulate the expression of cyclin D1, which leads to the suppression of cell growth.
12920129 IPCEF1 increases the in vitro and in vivo stimulation of ARFGTP formation by cytohesin 2

AA Sequence

MTSYMAIDGSALVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILK      1 - 70
GSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVI     71 - 140
HQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASSSSPSLSGTSYSFSSLENTVKTPSSF    141 - 210
PSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSS    211 - 280
LSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNP    281 - 350
SINEKLHKIRTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDT    351 - 420
PQELKKSPSSPSVENSI                                                         421 - 437
//

Text Mined References (18)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
22085542 2012 CNK3 and IPCEF1 produce a single protein that is required for HGF dependent Arf6 activation and migration.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20016009 2010 GRASP and IPCEF promote ARF-to-Rac signaling and cell migration by coordinating the association of ARNO/cytohesin 2 with Dock180.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19756519 2009 Peripheral nerve injury up-regulates expression of interactor protein for cytohesin exchange factor 1 (IPCEF1) mRNA in rat dorsal root ganglion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17067457 2006 [Expression of tumor suppressor gene PTEN, PIP3 and cyclin D1 in oral squamous cell carcinoma and their correlations].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...