Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.87
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.700 1.8e-05
astrocytic glioma -3.200 1.8e-03
Astrocytoma, Pilocytic -3.600 3.2e-09
atypical teratoid / rhabdoid tumor -4.200 1.2e-08
cutaneous lupus erythematosus 1.500 2.5e-02
Down syndrome -1.100 1.5e-03
ependymoma -4.000 1.7e-03
glioblastoma -3.600 1.1e-10
group 3 medulloblastoma -1.900 4.2e-02
lung cancer -1.800 1.2e-04
medulloblastoma, large-cell -5.200 1.9e-08
oligodendroglioma -2.800 1.0e-02
osteosarcoma -3.225 2.2e-06
pituitary cancer 2.300 3.8e-06
primitive neuroectodermal tumor -5.100 3.1e-08

Gene RIF (7)

AA Sequence

MTSYMAIDGSALVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILK      1 - 70
GSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVI     71 - 140
HQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASSSSPSLSGTSYSFSSLENTVKTPSSF    141 - 210
PSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSS    211 - 280
LSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNP    281 - 350
SINEKLHKIRTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDT    351 - 420
PQELKKSPSSPSVENSI                                                         421 - 437
//

Text Mined References (19)

PMID Year Title