Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 8
Funding $521,275.85
PubMed Score 13.59
PubTator Score 11.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.809 0.000
glioblastoma 1.600 0.000
primitive neuroectodermal tumor 1.300 0.033
non-small cell lung cancer -1.413 0.000
lung cancer -2.100 0.002
pediatric high grade glioma 1.300 0.000
sonic hedgehog group medulloblastoma 1.300 0.001
lung adenocarcinoma -1.200 0.000
ovarian cancer 1.100 0.000

Gene RIF (9)

PMID Text
23239578 structural and binding affinity between odin and arap3
23180820 Phosphoinositide 3-OH kinase (PI3K) is input into the regulation of beta2 integrin activity, and processes dependent on its responses, by signaling through its effector ARAP3.
22750419 The structural basis for the interaction between Arap3 and Vav2, hydrophobic pockets and binding specificity.
21076469 ARAP3 is a unique Src substrate that suppresses peritoneal dissemination of scirrhous gastric carcinoma cells.
19786092 None of the individual PH domains can bind to PtdIns(3,4,5)P3; rather, a fragment comprising two PH domains and an N-terminal linker is minimally required for binding.
17314030 In a yeast two-hybrid screen for new interaction partners of Arap3, the PI 5'-phosphatase SHIP2 was identified as an interaction partner of Arap3.
15569923 ARAP3 deficiency produced by antisense expression of an ARAP3 EST impaired entry of anthrax PA and its bound toxigenic moieties into both human and mouse cells, resulting in reduced toxin sensitivity
15546919 ARAP3 has a role in integrin-mediated tyrosine kinase signalling pathways controlling Rho GTPases and cell spreading
12832619 The catalytic domain of ARF-GAP alone is sufficient to initiate uncoating of liposome-derived COPI-coated vesicles. ARF-GAP activity is not required for COPI coat assembly & does not seem to be an essential coat component of COPI vesicles.

AA Sequence

MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGS      1 - 70
LDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPALGGPGVSRSPEPSPRPPPLPT     71 - 140
SSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSSQISAPTPALRPTTGTVHIMDPGCLYYGVQP    141 - 210
VGTPGAPDRRESRGVCQGRAEHRLSRQDLEAREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFS    211 - 280
FTADRLTPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQV    281 - 350
ITGQRVFVFRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA    351 - 420
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEAVTETLSDYE    421 - 490
VAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFI    491 - 560
VLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLFRKPHPQYPDHSQLLQALCAAVARPNLL    561 - 630
KNMTQLLCVEAFEGEEPWFPPAPDGSCPGLLPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRG    631 - 700
RDAPPRLWCVLGAALEMFASENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTD    701 - 770
GADSLEAWTSAVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP    771 - 840
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGGAAGGGGTGLQ    841 - 910
EQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTL    911 - 980
KRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLYRVQKCAALNQM    981 - 1050
CTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLI   1051 - 1120
MEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQAL   1121 - 1190
QWCQLPEPCSASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK   1191 - 1260
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSILKAQHDDQQP   1261 - 1330
VVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQEELEE   1331 - 1400
PVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLTSQKSLDQPFLSKSSTLGQEERPPEPPPGPP   1401 - 1470
SKSSPQARGSLEEQLLQELSSLILRKGETTAGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSS   1471 - 1540
QPLT                                                                     1541 - 1544
//

Publication (21)

PMID Year Title
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
23239578 2013 Heterotypic Sam-Sam association between Odin-Sam1 and Arap3-Sam: binding affinity and structural insights.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180820 2013 Phosphoinositide 3-OH kinase regulates integrin-dependent processes in neutrophils by signaling through its effector ARAP3.
22750419 2012 Identification and structural basis for a novel interaction between Vav2 and Arap3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21076469 2011 ARAP3 inhibits peritoneal dissemination of scirrhous gastric carcinoma cells by regulating cell adhesion and invasion.
19786092 2010 ARAP3 binding to phosphatidylinositol-(3,4,5)-trisphosphate depends on N-terminal tandem PH domains and adjacent sequences.
19765305 2009 The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...