Property Summary

NCBI Gene PubMed Count 58
Grant Count 69
R01 Count 26
Funding $21,756,152.73
PubMed Score 1175.19
PubTator Score 159.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WWM9 Q541Y7 Q8N2X5
Symbols HGB
STAP

Gene

PANTHER Protein Class (1)

PDB

1UMO   1URV   1URY   1UT0   1UX9   1V5H   2DC3   3AG0   4B3W  

Gene RIF (53)

PMID Text
26928591 Propose a bipartite lipid binding model that rationalizes the modes of interactions of cytoglobin with phospholipids, the effects on structural re-arrangements and the peroxidase activity of the hemoprotein.
26339645 This review provides an overview of the proposed role of cytoglobin and explores its potential functional role as a biomarker for cancer and other diseases
26096935 DeltaNp63-CYGB axis is also present in lung and breast cancer cell lines, indicating that CYGB-mediated ROS-scavenging activity may also have a role in epithelial tumours
25665792 Cygb, expressed in hepatic stellate cells during liver fibrosis, plays role in cancer development with nonalcoholic steatohepatitis.
25601563 The cysteine redox state of the monomer controls histidine dissociation rate constants and hence extrinsic ligand binding in human cytoglobin.
25327890 The monomeric cytoglobin protein with an internal disulfide bond between the two cysteine residues Cys38 and Cys83, interacts with lipids to induce a change in haem co-ordination.
25269893 Cygb stabilizes p53 by inhibiting its ubiquitination and elicit cell cycle arrest in DNA damaged cells.
24816917 This review outlines the current understanding of Cygb's involvement in tumor hypoxia and discusses its role in tumorigenesis.
24737588 Our data provides evidence that cytoglobin regulates the ovarian cancer cell proliferation and invasion.
24632414 Protein multimerization may be a mechanism that triggers physiological functions of human cytoglobin.
More...

AA Sequence

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL      1 - 70
EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA     71 - 140
SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP                        141 - 190
//

Publication (59)

PMID Year Title
26928591 2016 Peroxidase activation of cytoglobin by anionic phospholipids: Mechanisms and consequences.
26339645 2015 Cytoglobin as a Biomarker in Cancer: Potential Perspective for Diagnosis and Management.
26096935 2016 ?Np63 targets cytoglobin to inhibit oxidative stress-induced apoptosis in keratinocytes and lung cancer.
25665792 2015 Cytoglobin deficiency promotes liver cancer development from hepatosteatosis through activation of the oxidative stress pathway.
25601563 2015 Coupling of disulfide bond and distal histidine dissociation in human ferrous cytoglobin regulates ligand binding.
25416956 2014 A proteome-scale map of the human interactome network.
25327890 2015 Cytoglobin ligand binding regulated by changing haem-co-ordination in response to intramolecular disulfide bond formation and lipid interaction.
25269893 2014 DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.
24816917 2014 Cytoglobin in tumor hypoxia: novel insights into cancer suppression.
24737588 2014 Expression and biological role of cytoglobin in human ovarian cancer.
More...