Property Summary

NCBI Gene PubMed Count 60
PubMed Score 1269.70
PubTator Score 159.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (55)

AA Sequence

MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL      1 - 70
EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA     71 - 140
SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP                        141 - 190
//

Text Mined References (61)

PMID Year Title