Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.2e-03

Synonym

Accession Q8WWM1 Q5JS81 XAGE-5
Symbols CT12.5
GAGED5
XAGE-5

Gene

 Compartment GO Term (2)

AA Sequence

MSWRGRRYRPRRCLRLAQLVGPMLEPSVPEPQQEEPPTESQDHTPGQKREDDQGAAEIQVPNLEADLQEL      1 - 70
SQSKTGDECGDSPDVQGKILPKSEQFKMPEGGEGKPQL                                     71 - 108
//

Text Mined References (4)

PMID Year Title