Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Synonym

Accession Q8WWM1 Q5JS81 XAGE-5
Symbols CT12.5
GAGED5
XAGE-5

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRRYRPRRCLRLAQLVGPMLEPSVPEPQQEEPPTESQDHTPGQKREDDQGAAEIQVPNLEADLQEL      1 - 70
SQSKTGDECGDSPDVQGKILPKSEQFKMPEGGEGKPQL                                     71 - 108
//

Publication (4)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11992404 2002 The XAGE family of cancer/testis-associated genes: alignment and expression profile in normal tissues, melanoma lesions and Ewing's sarcoma.