Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.87
PubTator Score 15.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26037154 CCNB3 immunostaining was useful for differentiating BCOR-CCNB3 from a group of 'Ewing-like sarcomas' and may contribute to the evaluation of treatment strategies for bone sarcomas.
25360585 This study adds to recent reports on the clinicopathologic spectrum of BCOR-CCNB3 fusion-positive sarcomas, a newly emerging entity within the undifferentiated unclassified sarcoma category
24805859 Study provides a detailed description of the histologic spectrum, immunohistochemical features, and clinical characteristic of BCOR-CCNB3 sarcoma justifying distinction from Ewing sarcoma with its typical EWS/FUS-ETS translocations.
22387997 A new fusion was observed between BCOR (encoding the BCL6 co-repressor) and CCNB3 (encoding the testis-specific cyclin B3) on the X chromosome.
21404461 Increased expression of cyclin B3 maybe an important marker for identifying endoderm cells differentiated from human embryonic stem cells.
12185076 cloning of a full length cDNA; is expressed in developing male germ cells and is restricted to testis in mature tissues
11878934 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
11531413 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
10958988 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
9560267 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
More...

AA Sequence

MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKRSAFEDLTNAS      1 - 70
QCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLKWHKLEVTPVVASTTVVPNIMEKPLILDIS     71 - 140
TTSKTPNTEEASLFRKPLVLKEEPTIEDETLINKSLSLKKCSNHEEVSLLEKLQPLQEESDSDDAFVIEP    141 - 210
MTFKKTHKTEEAAITKKTLSLKKKMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPT    211 - 280
HKLSSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMSILKKSL    281 - 350
ALQKTNFKEDSLVKESLAFKKKPSTEEAIMMPVILKEQCMTEGKRSRLKPLVLQEITSGEKSLIMKPLSI    351 - 420
KEKPSTEKESFSQEPSALQKKHTTQEEVSILKEPSSLLKSPTEESPFDEALAFTKKCTIEEAPPTKKPLI    421 - 490
LKRKHATQGTMSHLKKPLILQTTSGEKSLIKEPLPFKEEKVSLKKKCTTQEMMSICPELLDFQDMIGEDK    491 - 560
NSFFMEPMSFRKNPTTEETVLTKTSLSLQEKKITQGKMSHLKKPLVLQKITSEEESFYKKLLPFKMKSTT    561 - 630
EEKFLSQEPSALKEKHTTLQEVSLSKESLAIQEKATTEEEFSQELFSLHVKHTNKSGSLFQEALVLQEKT    631 - 700
DAEEDSLKNLLALQEKSTMEEESLINKLLALKEELSAEAATNIQTQLSLKKKSTSHGKVFFLKKQLALNE    701 - 770
TINEEEFLNKQPLALEGYPSIAEGETLFKKLLAMQEEPSIEKEAVLKEPTIDTEAHFKEPLALQEEPSTE    771 - 840
KEAVLKEPSVDTEAHFKETLALQEKPSIEQEALFKRHSALWEKPSTEKETIFKESLDLQEKPSIKKETLL    841 - 910
KKPLALKMSTINEAVLFEDMIALNEKPTTGKELSFKEPLALQESPTYKEDTFLKTLLVPQVGTSPNVSST    911 - 980
APESITSKSSIATMTSVGKSGTINEAFLFEDMITLNEKPTTGKELSFKEPLALQESPTCKEDTFLETFLI    981 - 1050
PQIGTSPYVFSTTPESITEKSSIATMTSVGKSRTTTESSACESASDKPVSPQAKGTPKEITPREDIDEDS   1051 - 1120
SDPSFNPMYAKEIFSYMKEREEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLAVKLVD   1121 - 1190
LYLMKAVCKKDKLQLLGATAFMIAAKFEEHNSPRVDDFVYICDDNYQRSEVLSMEINILNVLKCDINIPI   1191 - 1260
AYHFLRRYARCIHTNMKTLTLSRYICEMTLQEYHYVQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGY   1261 - 1330
SISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL        1331 - 1395
//

Text Mined References (25)

PMID Year Title
26037154 2015 Screening of BCOR-CCNB3 sarcoma using immunohistochemistry for CCNB3: A clinicopathological report of three pediatric cases.
25360585 2015 BCOR-CCNB3 fusions are frequent in undifferentiated sarcomas of male children.
24805859 2014 BCOR-CCNB3 (Ewing-like) sarcoma: a clinicopathologic analysis of 10 cases, in comparison with conventional Ewing sarcoma.
22387997 2012 A new subtype of bone sarcoma defined by BCOR-CCNB3 gene fusion.
21404461 2011 Proteomic identification of overexpressed adenomatous polyposis coli and cyclin B3 during endoderm differentiation from human embryonic stem cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17174311 2007 Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...