Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.82
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WWL2 A4QPB1 Q2TA98 Q6P433 Q8ND47 Q96JJ5 Spir-2
Symbols Spir-2

Gene

Gene RIF (3)

PMID Text
26287480 This DNA damage-induced nuclear actin assembly requires two biologically and physically linked nucleation factors: Formin-2 and Spire-1/Spire-2.
25564607 We therefore characterized co-expressed Spir-2 and Fmn-2 fluorescent protein fusions . The data corroborate a model according to which Spir-2 exists in two different states, a cytosolic monomeric conformation and a membrane-bound state
19605360 both mammalian Spir proteins, Spir-1 and Spir-2, interact with mammalian Fmn subgroup proteins formin-1 and formin-2

AA Sequence

MARAGSCGGAAAGAGRPEPWELSLEEVLKAYEQPLNEEQAWAVCFQGCRGLRGSPGRRLRDTGDLLLRGD      1 - 70
GSVGAREPEAAEPATMVVPLASSEAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDS     71 - 140
GCGAADEGYGGPEEEEEAEGVPRSVRTFAQAMRLCAARLTDPRGAQAHYQAVCRALFVETLELRAFLARV    141 - 210
REAKEMLQKLREDEPHLETPRAELDSLGHTDWARLWVQLMRELRRGVKLKKVQEQEFNPLPTEFQLTPFE    211 - 280
MLMQDIRARNYKLRKVMVDGDIPPRVKKDAHELILDFIRSRPPLKQVSERRLRPLPPKQRSLHEKILEEI    281 - 350
KQERRLRPVRGEGWAARGFGSLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEM    351 - 420
NTSEEEESPCGEVTLKRDRSFSEHDLAQLRSEVASGLQSATHPPGGTEPPRPRAGSAHVWRPGSRDQGTC    421 - 490
PASVSDPSHPLLSNRGSSGDRPEASMTPDAKHLWLEFSHPVESLALTVEEVMDVRRVLVKAEMEKFLQNK    491 - 560
ELFSSLKKGKICCCCRAKFPLFSWPPSCLFCKRAVCTSCSIKMKMPSKKFGHIPVYTLGFESPQRVSAAK    561 - 630
TAPIQRRDIFQSLQGPQWQSVEEAFPHIYSHGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQT    631 - 700
QSLYIPNTRTLDFK                                                            701 - 714
//

Publication (11)

PMID Year Title
26287480 2015 DNA damage induces nuclear actin filament assembly by Formin -2 and Spire-½ that promotes efficient DNA repair. [corrected].
25564607 2015 Membrane targeting of the Spir·formin actin nucleator complex requires a sequential handshake of polar interactions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21620703 2011 Spire-type actin nucleators cooperate with Formin-2 to drive asymmetric oocyte division.
19605360 2009 Identification of a short Spir interaction sequence at the C-terminal end of formin subgroup proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...