Property Summary

NCBI Gene PubMed Count 32
PubMed Score 205.92
PubTator Score 107.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.102 7.0e-03
adrenocortical carcinoma 1.363 1.8e-04
atypical teratoid / rhabdoid tumor 1.200 1.3e-04
Breast cancer 1.600 7.0e-12
breast carcinoma 1.100 8.6e-06
colon cancer 1.800 1.1e-02
diabetes mellitus -1.300 2.2e-03
ductal carcinoma in situ 1.600 9.7e-05
glioblastoma 1.100 3.8e-05
group 3 medulloblastoma 1.800 7.4e-04
hepatocellular carcinoma -1.100 8.9e-04
intraductal papillary-mucinous carcinoma... 2.400 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.800 6.6e-03
invasive ductal carcinoma 1.500 7.8e-03
lung cancer 1.200 1.1e-02
lung carcinoma 1.200 1.5e-11
medulloblastoma, large-cell 1.900 1.0e-04
nasopharyngeal carcinoma 1.100 1.5e-03
non-small cell lung cancer 1.701 1.6e-17
osteosarcoma -1.558 1.3e-03
ovarian cancer 1.700 4.2e-04
primary Sjogren syndrome 1.400 3.1e-05
primitive neuroectodermal tumor 1.500 1.4e-04

Gene RIF (13)

AA Sequence

MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLSSSRDQRVVTSEDQVQEGTK      1 - 70
VLKLKTKMADKENMKRPAESKNNTVVGKHCIPLKPSNELTNSTVVIDTHKPKDSNQTPHLLLTEDDPQSQ     71 - 140
HMTLSQAFHLKNNSKKKQMTTEKQKQDANMPKKPVLGSYRGQIVQSKINSFRKPLQVKDESSAATKKLSA    141 - 210
TIPKATKPQPVNTSSVTVKSNRSSNMTATTKFVSTTSQNTQLVRPPIRSHHSNTRDTVKQGISRTSANVT    211 - 280
IRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGK    281 - 350
AIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFT    351 - 420
EKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILA    421 - 490
GAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQ    491 - 560
DCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYLQSVKKKVQFDGTNSAFKELKFLTPVRRSRR    561 - 630
LQEKTSKLPDMLKDHYPCVSSLEQLTELGRETDAFVCRPNAALCRVYYEADTT                     631 - 683
//

Text Mined References (38)

PMID Year Title