Property Summary

NCBI Gene PubMed Count 31
Grant Count 20
R01 Count 12
Funding $3,624,574.09
PubMed Score 191.72
PubTator Score 107.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
24887265 Chromatin CKAP2 is an independent prognostic marker for relapse-free survival in early-stage breast cancer, and could potentially replace the mitotic activity index in clinical evaluation of proliferation activity.
24280143 The transcriptional activity of RHOA, SEMA3B, and CKAP2 genes was assessed in blood samples of leukaemia patients and healthy donors.
24238125 expression might be a potential biologic marker for identifying hepatocellular carcinoma patients at risk of early and extensive recurrence after operative resection
23737987 CKAP2 is involved in the maintenance of microtubule nucleation sites
22465120 GC box was responsible for the cyclic activity of human CKAP2 promoter through the phosphorylation of Sp1, possibly by Cyclin A/Cdk complex.
20458174 Findings suggest that the motif surrounding Ser627 ((625) RRSRRL (630)) is a critical for kinase-substrate recognition and for regulation of the subcellular localization of TMAP during mitosis.
19641375 TMAP is limited to pre-anaphase stages and suggest that the multiple phosphorylation may not act in concert but serve diverse functions.
19369249 Cdk1-cyclin B1-mediated phosphorylation of TMAP is important for and contributes to proper regulation of microtubule dynamics and establishment of functional bipolar spindles during mitosis
17376772 CKAP2 is a physiological substrate of anaphase-promoting complex/cyclosome during mitotic exit and that a tight regulation of the CKAP2 protein level is critical for the normal mitotic progression.
17339342 Data show that degradation of TMAP/CKAP2 during mitotic exit is mediated by the anaphase-promoting complex bound to Cdh1 and that the KEN box motif near the N terminus is necessary for its destruction.
More...

AA Sequence

MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLSSSRDQRVVTSEDQVQEGTK      1 - 70
VLKLKTKMADKENMKRPAESKNNTVVGKHCIPLKPSNELTNSTVVIDTHKPKDSNQTPHLLLTEDDPQSQ     71 - 140
HMTLSQAFHLKNNSKKKQMTTEKQKQDANMPKKPVLGSYRGQIVQSKINSFRKPLQVKDESSAATKKLSA    141 - 210
TIPKATKPQPVNTSSVTVKSNRSSNMTATTKFVSTTSQNTQLVRPPIRSHHSNTRDTVKQGISRTSANVT    211 - 280
IRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGK    281 - 350
AIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFT    351 - 420
EKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILA    421 - 490
GAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGVDVDPEKLEMESKLHRNLLFQ    491 - 560
DCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYLQSVKKKVQFDGTNSAFKELKFLTPVRRSRR    561 - 630
LQEKTSKLPDMLKDHYPCVSSLEQLTELGRETDAFVCRPNAALCRVYYEADTT                     631 - 683
//

Text Mined References (37)

PMID Year Title
24887265 2014 Chromatin CKAP2, a new proliferation marker, as independent prognostic indicator in breast cancer.
24280143 2013 RHOA, SEMA3B, and CKAP2 expression in leukaemia of different types: the results of a pilot experiment.
24238125 2014 Cytoskeleton-associated protein 2 is a potential predictive marker for risk of early and extensive recurrence of hepatocellular carcinoma after operative resection.
23737987 2013 CKAP2 ensures chromosomal stability by maintaining the integrity of microtubule nucleation sites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22465120 2012 Cyclin A regulates a cell-cycle-dependent expression of CKAP2 through phosphorylation of Sp1.
22020800 2012 Condensed chromatin staining of CKAP2 as surrogate marker for mitotic figures.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21368580 2011 MiR-203 controls proliferation, migration and invasive potential of prostate cancer cell lines.
21328343 2011 Selective and efficient retardation of cancers expressing cytoskeleton-associated protein 2 by targeted RNA replacement.
More...