Property Summary

NCBI Gene PubMed Count 25
PubMed Score 38.00
PubTator Score 29.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.93410233926615E-19
lung adenocarcinoma 2714 9.66313187181819E-13
posterior fossa group B ependymoma 1530 1.61807114826219E-10
juvenile dermatomyositis 1189 3.25437129681452E-10
group 4 medulloblastoma 1875 1.31721301412655E-7
Breast cancer 3099 4.2706132993921E-7
glioblastoma 5572 7.46375956476314E-7
medulloblastoma, large-cell 6234 1.62510007991421E-6
atypical teratoid/rhabdoid tumor 1095 1.05513119012409E-5
ovarian cancer 8492 1.64044988828885E-5
pediatric high grade glioma 2712 2.51097739582794E-5
cystic fibrosis 1670 3.59807545580445E-5
osteosarcoma 7933 9.24469401479377E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 5.98786964584737E-4
pancreatic cancer 2300 7.56859354447261E-4
tuberculosis and treatment for 6 months 686 0.00113650316179961
lung cancer 4473 0.00233403136836086
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00279530245779233
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00366677598344416
invasive ductal carcinoma 2950 0.0039309172698387
pilocytic astrocytoma 3086 0.00469909911987895
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00502817113024256
diabetes mellitus 1663 0.00533079162837015
pancreatic carcinoma 567 0.00773166844016836
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00850914474904122
Pick disease 1893 0.0173465567397267
progressive supranuclear palsy 674 0.018950518914873
active ulcerative colitis 477 0.0276734921979767
primitive neuroectodermal tumor 3031 0.0401142334914829
Disease Target Count Z-score Confidence
Toxocariasis 6 4.874 2.4
nutritional deficiency disease 10 3.855 1.9

Expression

Synonym

Accession Q8WWI5 A6NLZ9 Q5VUB3 Q8WVB0 Q96KU3 Q9NY69
Symbols CD92
CTL1
CDW92
CHTL1

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
26671581 This study showed that SLC44A1-PRKCA fusion seems to be a specific characteristic of Papillary glioneuronal tumors with a high diagnostic value.
26601765 The differential expression pattern of CTL1 and CTL2 suggests that CTL1 is the key transporter involved in choline transport from maternal circulation and both transporters are likely involved in stromal and endothelial cell choline transport.
25466896 Reduced CTL1 expression is associated with postural orthostatic tachycardia syndrome.
23948665 NCI-H69 cells express the choline transporter CTL1 which uses a directed H(+) gradient as a driving force, and its transport functions in co-operation with NHE1.
22483272 REVIEW highlights discovery and characterization of SLC44A1, describes its expression patterns and subcellular localization and summarizes evidence for the role of this choline transporter in the central nervous system.
21185344 CTL1 is expressed in both SH-SY5Y and LA-N-2 cells and is responsible for choline uptake that relies on a directed hydrogen ion gradient as a driving force.
20410607 In conclusion, choline transport in A549 cells is increased by treatment with DEX, and the increase is mediated by induction of functional choline transporters CTL1 and CTL2.
19519661 The presence of CTL1 protein in rat and human CNS regions, where it is found in neuronal, glial and endothelial cells, suggests that malfunction of this transporter could have important implications in nervous system development and repair.
19357133 SLC44A1 mRNA and protein expression were down-regulated during choline deficiency.
16609143 characterization the 5'-flanking region of the human (h)CTL1 gene and some of the possible mechanisms of its regulation, including promoter activity, splicing, and expression
More...

AA Sequence

MGCCSSASSAAQSSKREWKPLEDRSCTDIPWLLLFILFCIGMGFICGFSIATGAAARLVSGYDSYGNICG      1 - 70
QKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALC     71 - 140
SYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT    141 - 210
SKEIILGLCLLSLVLSMILMVIIRYISRVLVWILTILVILGSLGGTGVLWWLYAKQRRSPKETVTPEQLQ    211 - 280
IAEDNLRALLIYAISATVFTVILFLIMLVMRKRVALTIALFHVAGKVFIHLPLLVFQPFWTFFALVLFWV    281 - 350
YWIMTLLFLGTTGSPVQNEQGFVEFKISGPLQYMWWYHVVGLIWISEFILACQQMTVAGAVVTYYFTRDK    351 - 420
RNLPFTPILASVNRLIRYHLGTVAKGSFIITLVKIPRMILMYIHSQLKGKENACARCVLKSCICCLWCLE    421 - 490
KCLNYLNQNAYTATAINSTNFCTSAKDAFVILVENALRVATINTVGDFMLFLGKVLIVCSTGLAGIMLLN    491 - 560
YQQDYTVWVLPLIIVCLFAFLVAHCFLSIYEMVVDVLFLCFAIDTKYNDGSPGREFYMDKVLMEFVENSR    561 - 630
KAMKEAGKGGVADSRELKPMASGASSA                                               631 - 657
//

Text Mined References (29)

PMID Year Title
26671581 2015 Papillary glioneuronal tumors: histological and molecular characteristics and diagnostic value of SLC44A1-PRKCA fusion.
26601765 2015 Characterization of choline transporters in the human placenta over gestation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25466896 2015 Mechanism of choline deficiency and membrane alteration in postural orthostatic tachycardia syndrome primary skin fibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948665 2013 Functional expression of choline transporter-like protein 1 (CTL1) in small cell lung carcinoma cells: a target molecule for lung cancer therapy.
22483272 2012 The ubiquitous choline transporter SLC44A1.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21185344 2011 Functional expression of choline transporter-like protein 1 (CTL1) in human neuroblastoma cells and its link to acetylcholine synthesis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...