Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.23
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 7.75326464660488E-24
medulloblastoma, large-cell 6234 0.00127092971409825
breast carcinoma 1614 0.00360165381797459
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0112332815067633
Breast cancer 3099 0.0265848840380967
astrocytic glioma 2241 0.042589169409374
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 3.756 1.9
Phenylketonuria 18 3.528 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 0.043
glioblastoma multiforme -1.200 0.000
medulloblastoma, large-cell 1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.182 0.011
breast carcinoma 1.200 0.004
Breast cancer 2.600 0.027

Synonym

Accession Q8WWH5 B2R716 Q53ES2
Symbols PUS4

Gene

PANTHER Protein Class (1)

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (2)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
12736709 TRUB1 gene encodes a 349-amino acid product, with a VFAVHKPKGPTSA box in positions 71-83 corresponding to motif I of the TruB family

AA Sequence

MAASEAAVVSSPSLKTDTSPVLETAGTVAAMAATPSARAAAAVVAAAARTGSEARVSKAALATKLLSLSG      1 - 70
VFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLT     71 - 140
SMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRL    141 - 210
STLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQ    211 - 280
GPFTLEEHALPEDKWTIDDIAQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKREDDVIKTC     281 - 349
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...