Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.58
PubTator Score 15.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -1.100 8.2e-03
mucosa-associated lymphoid tissue lympho... -1.363 6.4e-03
osteosarcoma -1.427 3.0e-07

 MGI Phenotype (1)

Gene RIF (12)

AA Sequence

MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAV      1 - 70
LVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH                              71 - 115
//

Text Mined References (21)

PMID Year Title