Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.76
PubTator Score 15.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.95442247329528E-7
mucosa-associated lymphoid tissue lymphoma 480 0.0064478865626482
gastric carcinoma 832 0.00819164936096477
Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.427 0.000
gastric carcinoma -1.100 0.008
mucosa-associated lymphoid tissue lympho... -1.363 0.006

Synonym

Accession Q8WWG1 A6NIE8 Pro-NRG4
Symbols HRG4

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid

 MGI Term (1)

Gene RIF (11)

PMID Text
26476959 Nrg4 might have a protective role in the development of Non-alcoholic fatty liver disease (NAFLD).
25401691 results establish Nrg4 as a brown fat-enriched endocrine factor with therapeutic potential for the treatment of obesity-associated disorders, including type 2 diabetes and nonalcoholic fatty liver disease (NAFLD).
25216938 NRG4 and its receptor ErbB4 are present in human breast milk and developing human intestine, respectively. Thus, NRG4-ErbB4 signaling may be a novel pathway for therapeutic intervention or prevention in NEC.
23033483 Pharmacological inhibition of PI3K/Akt signaling reversed the anti-apoptotic effects of NRG4, confirming the role of this cascade in NRG4-induced cell survival
21805036 The recombinant neuregulin 4 induced the tyrosine phosphorylation of HER4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17962208 NRG4 was positive in almost all breast cancers studied.
17684490 describes a novel splice variant of the NRG4 gene, NRG4A2, which encodes a C-terminal region containing a predicted type I PDZ-binding peptide
17545517 NRG4 overexpression is associated with advanced-stage prostate cancer
More...

AA Sequence

MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAV      1 - 70
LVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH                              71 - 115
//

Text Mined References (20)

PMID Year Title
26476959 2015 A case-control study: Association between serum neuregulin 4 level and non-alcoholic fatty liver disease.
25416956 2014 A proteome-scale map of the human interactome network.
25401691 2014 The brown fat-enriched secreted factor Nrg4 preserves metabolic homeostasis through attenuation of hepatic lipogenesis.
25216938 2014 The ErbB4 ligand neuregulin-4 protects against experimental necrotizing enterocolitis.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23033483 2012 Neuregulin-4 is a survival factor for colon epithelial cells both in culture and in vivo.
21805036 The role of neuregulin4 and HER4 in gastrointestinal malignant lymphoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...