Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.84
PubTator Score 1.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Endometriosis -1.348 2.5e-02
ependymoma 4.300 4.4e-10
group 3 medulloblastoma -1.300 5.9e-03
nasopharyngeal carcinoma -3.100 1.4e-07
psoriasis -1.100 4.5e-02

Gene RIF (1)

AA Sequence

MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLND      1 - 70
YAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVY     71 - 140
NAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL      141 - 208
//

Text Mined References (7)

PMID Year Title