Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.84
PubTator Score 1.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 6.200 0.000
group 3 medulloblastoma -1.300 0.006
nasopharyngeal carcinoma -3.100 0.000
Endometriosis -1.348 0.025
psoriasis -1.100 0.045

Gene RIF (1)

PMID Text
18563381 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLND      1 - 70
YAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVY     71 - 140
NAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL      141 - 208
//

Publication (7)

PMID Year Title
18563381 2008 Study of the association between the CAPSL-IL7R locus and type 1 diabetes.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.