Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

AA Sequence

MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGE      1 - 70
AGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTP     71 - 140
FLCLQ                                                                     141 - 145
//

Text Mined References (8)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18184612 2008 Structure of msj-1 gene in mice and humans: a possible role in the regulation of male reproduction.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15891074 2005 Structure of msj-1 gene: a comparative analysis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.