Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.39
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q8WWF5 A8K886 O75866
Symbols spzn
RNF204
Ssrzf1
SPERIZIN

Gene

Gene RIF (2)

PMID Text
21205830 Nixin/ZNRF4 to be central for the regulation of calnexin turnover.
10191088 Characterization and study of mouse homolog.

AA Sequence

MPLCRPEHLMPRASRVPVAASLPLSHAVIPTQLPSRPGHRPPGRPRRCPKASCLPPPVGPSSTQTAKRVT      1 - 70
MGWPRPGRALVAVKALLVLSLLQVPAQAVVRAVLEDNSSSVDFADLPALFGVPLAPEGIRGYLMEVKPAN     71 - 140
ACHPIEAPRLGNRSLGAIVLIRRYDCTFDLKVLNAQRAGFEAAIVHNVHSDDLVSMTHVYEDLRGQIAIP    141 - 210
SVFVSEAASQDLRVILGCNKSAHALLLPDDPPCHDLGCHPVLTVSWVLGCTLALVVSAFFVLNHLWLWAQ    211 - 280
ACCSHRRPVKTSTCQKAQVRTFTWHNDLCAICLDEYEEGDQLKILPCSHTYHCKCIDPWFSQAPRRSCPV    281 - 350
CKQSVAATEDSFDSTTYSFRDEDPSLPGHRPPIWAIQVQLRSRRLELLGRASPHCHCSTTSLEAEYTTVS    351 - 420
SAPPEAPGQ                                                                 421 - 429
//

Publication (6)

PMID Year Title
21205830 2011 A systematic search for endoplasmic reticulum (ER) membrane-associated RING finger proteins identifies Nixin/ZNRF4 as a regulator of calnexin stability and ER homeostasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10191088 1999 Sperizin is a murine RING zinc-finger protein specifically expressed in Haploid germ cells.