Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

AHHSRQKPSVTPPMKRDSQEESSISDINKKFSKF                                        211 - 244

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.