Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 8.62895034270169E-9
malignant mesothelioma 3163 2.22202445055128E-6
ulcerative colitis 2087 6.33110867042513E-5
interstitial cystitis 2299 8.86900562576524E-5
group 4 medulloblastoma 1875 1.92306179349758E-4
pituitary cancer 1972 0.00137115011163376
subependymal giant cell astrocytoma 2287 0.00250265831375173
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00267331570048049
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00285594640085316
gastric carcinoma 832 0.00866713908666797
ovarian cancer 8492 0.00989117967621793
colon cancer 1475 0.0172578486599143
acute myeloid leukemia 785 0.0296418810675771

Expression

AA Sequence

MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDI      1 - 70
TEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM              71 - 131
//

Text Mined References (9)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.