Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.283 2.1e-02

 GO Function (1)

Gene RIF (1)

AA Sequence

MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQG      1 - 70
SRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFS     71 - 140
ITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDIS    141 - 210
IYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWT    211 - 280
IARIEHSKLLE                                                               281 - 291
//

Text Mined References (14)

PMID Year Title