Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.12
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.115 2.3e-02
aldosterone-producing adenoma -1.037 2.3e-02
Astrocytoma, Pilocytic 1.500 1.6e-08
ependymoma -1.500 4.0e-02
glioblastoma 1.400 9.7e-06
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-02
osteosarcoma -1.307 4.2e-02
ovarian cancer 1.700 4.6e-04
pancreatic ductal adenocarcinoma liver m... -1.377 7.4e-03
pediatric high grade glioma 1.500 7.2e-04
sarcoidosis -1.200 2.6e-03
subependymal giant cell astrocytoma 1.538 4.3e-02
tuberculosis 1.100 2.2e-04

Gene RIF (1)

AA Sequence

MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHY      1 - 70
VWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAA     71 - 140
KPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLL    141 - 210
HTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFA    211 - 280
QWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYL    281 - 350
SWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN                  351 - 406
//

Text Mined References (16)

PMID Year Title