Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.93
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.66910961555134E-8
glioblastoma 5572 9.7281070317881E-6
tuberculosis 1563 3.89744572220633E-5
ovarian cancer 8492 4.5534163092891E-4
pediatric high grade glioma 2712 7.23154750806279E-4
sarcoidosis 368 0.00264569270406763
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00744252897580937
subependymal giant cell astrocytoma 2287 0.0133022297215162
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0155796737183639
active Crohn's disease 918 0.0227478326479861
aldosterone-producing adenoma 664 0.0227871779344322
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0249202621054517
ependymoma 2514 0.0400075650370029
osteosarcoma 7933 0.0417313039536154

Expression

Synonym

Accession Q8WWB7 A6NH16 B4DJN4 Q5SZX4 Q6UX96 Q8IV07 Q96F65
Symbols NCU-G1
C1orf85

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (1)

PMID Text
18021396 NCU-G1 is a dual-function protein capable of functioning as a transcription factor as well as a nuclear receptor co-activator.

AA Sequence

MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHY      1 - 70
VWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAA     71 - 140
KPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLL    141 - 210
HTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFA    211 - 280
QWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYL    281 - 350
SWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN                  351 - 406
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19556463 2009 A gene network regulating lysosomal biogenesis and function.
19489740 2009 NCU-G1 is a highly glycosylated integral membrane protein of the lysosome.
18021396 2007 Human NCU-G1 can function as a transcription factor and as a nuclear receptor co-activator.
17897319 2007 Integral and associated lysosomal membrane proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...