Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 8.4e-11
Disease Target Count Z-score Confidence
Persistent generalized lymphadenopathy 15 4.143 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 2.600 8.4e-11

AA Sequence

METSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINL      1 - 70
CQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKF     71 - 140
QFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQV    141 - 210
SGKAVCLIEEISSTEIQVEMKMPAYELKIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEDDLLIEVSE    211 - 280
KYRLHLNLPKLIDTEMTTAKFIKEKSTLIITMPLV                                       281 - 315
//

Text Mined References (10)

PMID Year Title