Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.09
PubTator Score 1.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEM      1 - 70
MERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSG     71 - 140
KTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL                                     141 - 177
//

Text Mined References (11)

PMID Year Title