Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.14891543947584E-12
non-small cell lung cancer 2798 5.1921052307609E-9
interstitial cystitis 2299 5.86337108191302E-5
nasopharyngeal carcinoma 1056 7.64502437761133E-4
pancreatic cancer 2300 0.00178469508369224
pancreatic carcinoma 567 0.00178469508369227
osteosarcoma 7933 0.0113424416811248
esophageal adenocarcinoma 737 0.0212241268851329
mucosa-associated lymphoid tissue lymphoma 480 0.0316402662171759
spina bifida 1064 0.0391834348446806

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.500 0.002
esophageal adenocarcinoma -1.400 0.021
psoriasis 1.600 0.000
osteosarcoma -1.616 0.011
non-small cell lung cancer 1.664 0.000
interstitial cystitis -2.000 0.000
pancreatic carcinoma 1.500 0.002
nasopharyngeal carcinoma -1.300 0.001
spina bifida -2.270 0.039
mucosa-associated lymphoid tissue lympho... 1.388 0.032

Synonym

Accession Q8WWA1 C9JID5 Q8NAL4 Q9NUZ4
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

METSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERNKSSSSSSSSSSSSSSSSSSSSS      1 - 70
ESNDEDQQPRATGKHRRSLGAGYPHGNGSPGPGHGEPDVLKDELQLYGDAPGEVVPSGESGLRRRGSDPA     71 - 140
SGEVEASQLRRLNIKKDDEFFHFVLLCFAIGALLVCYHYYADWFMSLGVGLLTFASLETVGIYFGLVYRI    141 - 210
HSVLQGFIPLFQKFRLTGFRKTD                                                   211 - 233
//

Text Mined References (7)

PMID Year Title
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.