Property Summary

NCBI Gene PubMed Count 151
PubMed Score 337.00
PubTator Score 289.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.016 2.7e-02
active ulcerative colitis 1.767 4.2e-02
lung adenocarcinoma -1.200 1.6e-05
osteosarcoma -2.182 1.1e-06
ovarian cancer -10.000 1.8e-38
pancreatic ductal adenocarcinoma liver m... -1.305 1.8e-03
rhinitis with controlled asthma 2.200 5.0e-02

Gene RIF (138)

AA Sequence

MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFC      1 - 70
DMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYY     71 - 140
DIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVV    141 - 210
YDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQC    211 - 280
GDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR                                         281 - 313
//

Text Mined References (153)

PMID Year Title