Property Summary

NCBI Gene PubMed Count 128
Grant Count 44
R01 Count 29
Funding $8,113,244.62
PubMed Score 297.92
PubTator Score 289.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
rhinitis with controlled asthma 2.200 0.050
uncontrolled asthma 4.400 0.000
osteosarcoma -2.182 0.000
pancreatic ductal adenocarcinoma liver m... -1.305 0.002
active Crohn's disease 1.016 0.027
ulcerative colitis 1.900 0.047
lung adenocarcinoma -5.100 0.000
ovarian cancer -10.000 0.000

 GO Function (1)

Gene RIF (115)

PMID Text
26904686 The concentrations of gastric peptide(Ghrelin and obestatin)and adipocytokines(omentin and Apelin ) across all subgroups were lower than in the control group. The differences were statistically significant (p < 0.0001), which may be of importance in the development of the disease complications
26539805 Data show that the circulating omentin-1 levels were dramatically decreased in renal cell carcinoma (RCC) patients.
26514948 Plasma omentin-1 concentrations were decreased in non-obese polycystic ovary syndrome individuals
26466574 Serum omentin was associated with cardiac autonomic neuropathy in type 2 diabetes patients.
26316585 This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals.
26293449 A decrease in omentin-1 levels could be an independent mortality risk factor in patient with diabetes on hemodialysis.
26291814 Omentin levels were lower in both obese and non-obese PCOS patients compared to healthy controls.
26277181 Omentin enhances insulin-stimulated glucose uptake in subcutaneous and visceral adipose tissue. omentin increases phosphorylation of AMP-activated protein kinase, which indicates a potential role of omentin in energy homeostasis.
26148048 Data indicate that none of the intelectin 1 (hIntL-1) ligands identified on the microbial glycan array are found in mammalian glycans.
26144294 analysis of expression of maternal omentin-1 in humans and in the rat animal model
More...

AA Sequence

MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFC      1 - 70
DMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYY     71 - 140
DIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVV    141 - 210
YDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQC    211 - 280
GDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR                                         281 - 313
//

Publication (130)

PMID Year Title
26904686 2016 Assessment of Serum Concentrations of Ghrelin, Obestatin, Omentin-1, and Apelin in Children with Type 1 Diabetes.
26539805 2016 Circulating levels of adipocytokine omentin-1 in patients with renal cell cancer.
26514948 2015 The correlation of plasma omentin-1 with insulin resistance in non-obese polycystic ovary syndrome.
26466574 2015 Association of serum omentin levels with cardiac autonomic neuropathy in patients with type 2 diabetes mellitus: a hospital-based study.
26316585 2016 The impact of acute aerobic exercise on chitinase 3-like protein 1 and intelectin-1 expression in obesity.
26293449 2015 Serum omentin-1 levels as a possible risk factor of mortality in patients with diabetes on haemodialysis.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26277181 2015 [Omentin - a newly-discovered adipocytokine in insulin resistance pathogenesis].
26148048 2015 Recognition of microbial glycans by human intelectin-1.
26144294 2015 Maternal serum omentin-1 profile is similar in humans and in the rat animal model.
More...