Property Summary

NCBI Gene PubMed Count 128
PubMed Score 297.92
PubTator Score 289.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
rhinitis with controlled asthma 2.200 0.050
uncontrolled asthma 4.400 0.000
osteosarcoma -2.182 0.000
pancreatic ductal adenocarcinoma liver m... -1.305 0.002
active Crohn's disease 1.016 0.027
ulcerative colitis 1.900 0.047
lung adenocarcinoma -5.100 0.000
ovarian cancer -10.000 0.000

Synonym

Accession Q8WWA0 Q5IWS4 Q5VYI4 Q6YDJ3 Q9NP67 ITLN-1
Symbols HL1
LFR
HL-1
INTL
ITLN
hIntL
omentin

Gene

PDB

4WMQ   4WMY  

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Opossum OMA Inparanoid

 GO Function (1)

Gene RIF (115)

PMID Text
26904686 The concentrations of gastric peptide(Ghrelin and obestatin)and adipocytokines(omentin and Apelin ) across all subgroups were lower than in the control group. The differences were statistically significant (p < 0.0001), which may be of importance in the development of the disease complications
26539805 Data show that the circulating omentin-1 levels were dramatically decreased in renal cell carcinoma (RCC) patients.
26514948 Plasma omentin-1 concentrations were decreased in non-obese polycystic ovary syndrome individuals
26466574 Serum omentin was associated with cardiac autonomic neuropathy in type 2 diabetes patients.
26316585 This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals.
26293449 A decrease in omentin-1 levels could be an independent mortality risk factor in patient with diabetes on hemodialysis.
26291814 Omentin levels were lower in both obese and non-obese PCOS patients compared to healthy controls.
26277181 Omentin enhances insulin-stimulated glucose uptake in subcutaneous and visceral adipose tissue. omentin increases phosphorylation of AMP-activated protein kinase, which indicates a potential role of omentin in energy homeostasis.
26148048 Data indicate that none of the intelectin 1 (hIntL-1) ligands identified on the microbial glycan array are found in mammalian glycans.
26144294 analysis of expression of maternal omentin-1 in humans and in the rat animal model
More...

AA Sequence

MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFC      1 - 70
DMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYY     71 - 140
DIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVV    141 - 210
YDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQC    211 - 280
GDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR                                         281 - 313
//

Text Mined References (130)

PMID Year Title
26904686 2016 Assessment of Serum Concentrations of Ghrelin, Obestatin, Omentin-1, and Apelin in Children with Type 1 Diabetes.
26539805 2016 Circulating levels of adipocytokine omentin-1 in patients with renal cell cancer.
26514948 2015 The correlation of plasma omentin-1 with insulin resistance in non-obese polycystic ovary syndrome.
26466574 2015 Association of serum omentin levels with cardiac autonomic neuropathy in patients with type 2 diabetes mellitus: a hospital-based study.
26316585 2016 The impact of acute aerobic exercise on chitinase 3-like protein 1 and intelectin-1 expression in obesity.
26293449 2015 Serum omentin-1 levels as a possible risk factor of mortality in patients with diabetes on haemodialysis.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26277181 2015 [Omentin - a newly-discovered adipocytokine in insulin resistance pathogenesis].
26148048 2015 Recognition of microbial glycans by human intelectin-1.
26144294 2015 Maternal serum omentin-1 profile is similar in humans and in the rat animal model.
More...