Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary


No data available



Accession Q8WW62 Q6UXN5
Symbols p24g5


Gene RIF (1)

26045774 TMED6-COG8 chimera might act as a novel diagnostic marker in TFE3 translocation renal cell carcinoma.

AA Sequence

VIILSGILQLYFLKRLFNVPTTTDTKKPRC                                            211 - 240

Publication (4)

PMID Year Title
26045774 2015 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.