Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q8WW62 Q6UXN5
Symbols p24g5
PRO34237
SPLL9146

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSY      1 - 70
EVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFY     71 - 140
EGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSL    141 - 210
VIILSGILQLYFLKRLFNVPTTTDTKKPRC                                            211 - 240
//

Text Mined References (4)

PMID Year Title